current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF08521.10; B1Y781_LEPCP/20-172; Two-component sensor kinase N-terminal, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst VGLLVAINTWSLYHQALRSADTAYDRTLLASAKSIGELLEVTGNSDALQVRANVPYSALEAFEADNRSRIFFKVSGFGGEMVSGFEDLPAWQGRIPVRGPYAALVDFYDDHYRGEPVRVAVLLQPVSGQAGQGMATIQVAETLELRQTLARQMLast
1 -8.540[R] COG3726 Uncharacterized membrane protein affecting hemolysin expression  ali follow..  10  18ICLALLVLLMQGASYFSLSHQLARSEQVEELAQTLAKQVAFSLSPIMDSGDDNIDSQKVDAILQQLTQSLDASVYQIDGTLVASAGE.................................................................. 107
2 -7.730[T] COG2770 FOG: HAMP domain  ali follow..  17SEAVVGLFGWSQREPIRREVMRQIKTQQTALVRESANNLRQRLDIYLGLLEITSPEQEAAFNASIAPAAGLFDLATADGTVTAVSPYRE-----GVIGINIADRDYFKQVMVVDQPT----ISAPLRNRVGGEPVVTFAAPVHDREGRIIGLI 173
3 -7.140[T] COG3614 Predicted periplasmic ligand-binding sensor domain  ali follow..  28LIFLIIFGGVAVAHWRIEMVSQQMRQQLLSQVEMVSLNLNFRLFQELSFTPQDLENPSFQRLHNQFEHRSIYTMVIRSGKILFGPDSLKSGDFLARDPGAVYKNP................................................ 139
4 -5.380[R] KOG3536 Adaptor protein CED-6, contains PTB domain  ali follow..  121..........VRFLGSMAVKTDSTTEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQSLRLIDPQTQVSRAFELTS------------------------------VTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAI 234
5 -5.250[M] KOG3396 Glucosamine-phosphate N-acetyltransferase  ali follow..  12  2..................SSISIFDEILLPTDISVPTGLRLRALRNDDFGYLEL-RKQFDAMKKAKSYYIVVLEHIESSKIIGAATLLIEFKYIHEAGTRGRVEDVVVDEKMRGKKLGALLNEVLVEMAKTIGVYKLSLECKTELIP...... 144
6 -5.070[V] COG3725 Membrane protein required for beta-lactamase induction  ali follow..  12  75LLIGLLCIGAGKVRLHYHAYLTAASRNDSHARATMAGELTMIHGVPAGCDEREYLRELQNALLWINFRFYLLIVGGTWGPVTLMGYAFLRAWQYWLARYQTPHHRLQSGIDLDWVPVRLAGVVYALIGH........................ 213
7 -5.050[T] COG3290 Signal transduction histidine kinase regulating citrate/malate metabolism  ali follow..  10  29LFSVLLVVHLIYFSQISDMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAV--RKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQIND. 178
8 -4.960[T] KOG3884 Neural proliferation, differentiation and control protein  ali follow..  13  343TVGLLALGVTWFHNRHKAAADVEYDRKLAQSAQMYHYQHQKQQIIAMENQATDGSCGMSDVESDDDNEEGDYTVYECPGLAPTGEMEVKNPAAAATNNNITQATPQQPATLKKGTVKPNINL---ATGTAAAAASAASAASATGGEEPKQKR. 532
9 -4.720[S] COG4104 Uncharacterized conserved protein  ali follow..  14  131.......................................................................VRVWSSGGWNAFDTTD-------------------------DGMTSWIER--------PTAEILYIDLVQRCDA........ 172
10 -4.690[S] KOG4528 Uncharacterized conserved protein  ali follow..  11  42...........KYEYLDHTADDTLEEAFEQCAMAMFGYMDTGTVEPLQTVEVETQGDDLQSLLFHFLDEWLYKFSADEFFIPREVKVLSIDQRNFKLRSIGWGEEFSLSKHPQGTEVKAITYSA------------MQVYNEENPEVFVIIDI 179

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.