current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF08975.10; B9JYZ4_AGRVS/31-145; Domain of unknown function (DUF1868 topsan), from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst RFDAEGNFLPEPGNTIVCHLRAGSESQKAIVALQERYKQMPEADHLAVTPASSLHMTLFQGIIEYRRTAVFWPKDLPLDAPIDDMTEILAQRLTYFAPGPDFRMKIARMLPTGLRLast
1 -20.900[S] COG5255 Uncharacterized protein conserved in bacteria  ali follow..  53  119RYDISGNFLTEPGNTVVSHLVSGSPSEAVVLEIRERMLAMPDADRLAFTPVSSLHMTLFQGIIEYRRRLPYWPQDVPLDTSIDAMTRLYLERLKGFEGFGPFNIKVVEVVPTGLT 233
2 -6.380[R] COG5565 Bacteriophage terminase large (ATPase) subunit and inactivated derivatives  ali follow..  11  171..AYEQGRAKWQANTVDYVWFDEEPPEDVYFEGITRTNATRGAIAVTFTPLRGLSAVVARYLMEKSPDRAVITMTIEDAEHYTP---QERQRVIDSYPAHEREARTRG....... 273
3 -5.940[K] KOG2814 Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family)  ali follow..  11  152.............THFLAVALNSGEVKERFMELKKCILEAELPGI-LFTPECCIHLTLGVYVLLDDIERQ----------EALKNLESCRRLLDGLKIPFQIKVKGLEIM..... 240
4 -5.920[R] COG3136 Uncharacterized membrane protein required for alginate biosynthesis  ali follow..  13  25NYYIAGLIPLFPTFALIAHYIVASE--------IDAMRTTIAFSMWSIIPYFIYLATLWYFSGVMRLPVAL............................................ 89
5 -5.540[J] COG1514 2`-5` RNA ligase  ali follow..  11  4...............LFTALEIPRNAAMSLSLLRGGLPGARW------IDVENYHITL-------------------IGDVDWRTADEIIDRLDRIERP-EFQLQLSGTGAFGSK 79
6 -5.160[T] KOG4458 Nitric oxide synthase-binding protein, contains PTB domain  ali follow..  11  34........AKYVGSLDVPRPNSRVEIVAAMRRIRYEFKAKNIKKKKVSIMVSVDGVKVIL....................................................... 85
7 -5.160[H] COG0302 GTP cyclohydrolase I  ali follow..  13  105....EHHMVPIIGKAHVAYLPEGRDIFARRLQTQESITAQIADSIQRILKPEAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLIRT.................... 213
8 -5.120[O] COG0638 20S proteasome, alpha and beta subunits  ali follow..  11  17.FSPDGSLYQVDGWTAIGIKSKSSVVIASEKRKAQSLLDVDSIEKVFLID-DHVGCSFAGLASDGRVIALQHRLIYDEPVSIDYLTKSVADVKQMYTQHGGVRPFGVALVIAG.. 142
9 -4.930[C] COG0822 NifU homolog involved in Fe-S cluster formation  ali follow..  10  57KFKTYGCGSAIASSSLITEWVKGKSLDDALAEIAEELELPPVKIHCSILAEDAVKAAVADYRKRQENR............................................... 128
10 -4.860[S] COG2357 Uncharacterized protein conserved in bacteria  ali follow..  12  56KARRKSTMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKERSYHLVV-----LYPLQTVSGEKHVLVEIQIRTLAMNFWATIE..................... 154

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.