current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF10417.9; A4AVJ3_MARSH/157-196; C-terminal domain of 1-Cys peroxiredoxin, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst SLQLTAYHKVATPANWEHGQDVVVSPAIPTNEAREMFDKGLast
1 -13.300[O] KOG0852 Alkyl hydroperoxide reductase, thiol specific antioxidant and related enzymes  ali follow..  32  205AFQYTDTHGEVCPAGWRPGADTIVPNP---EEKTKYFAKN 241
2 -10.400[O] COG0450 Peroxiredoxin  ali follow..  24  154AAQYVAAHGEVCPAKWEEGEKTLAPSLDLVGKI....... 187
3 -6.020[S] COG5435 Uncharacterized conserved protein  ali follow..  1.MYYFNEGSLELPEAWRDMTVNVLTSSLDETVGLS..... 34
4 -5.670[L] COG3285 Predicted eukaryotic-type DNA primase  ali follow..  12  232SPRARPGATVSMPLTWAQVKTDLDPKRFTLRTVPGLLAKS 271
5 -3.950[O] COG2994 ACP:hemolysin acyltransferase (hemolysin-activating protein)  ali follow..  13  86...LQSNDVLRHSENWCSGNRMWLINWFAPFGDSRMMKR. 121
6 -3.630[S] COG1935 Uncharacterized conserved protein  ali follow..  32  24TIELRSAHNVATALKAEPGDCVFLTPARIND......... 54
7 -3.080[S] COG3671 Predicted membrane protein  ali follow..  20  116.YYLVRGEAYPRPRSW........................ 130
8 -2.930[S] COG3612 Uncharacterized protein conserved in archaea  ali follow..  69.....STSGIVVPLDFTVSEKDLFSASKDKPLIDRILDA. 102
9 -2.890[G] KOG3765 Predicted glycosyltransferase  ali follow..  21  10KFLAASLSLLCIPATWEDGKPVSLSPLESQAHSPRYTA.. 56
10 -2.680[N] COG5461 Type IV pili component  ali follow..  15  198SYQNNLAAQMANPADLLGPRKQTTIDAENRGKVIDVYRAR 237

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 0 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.