current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF16078.5; H6C9R5_EXODN/72-112; 2-oxoglutarate dehydrogenase N-terminus, from PfamA32U

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40
# Score Template Links and tools%idFirst DSFLSGNAANYIDEMYLAWKQDPSSVHVSWQAYFHNMEEGNLast
1 -17.300[C] COG0567 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes  ali follow..  31  12SSYLAGANQSYIEQLYEDFLTDPGSVDDSWRSIFQQLPTTG 52
2 -4.020[M] COG0682 Prolipoprotein diacylglyceryltransferase  ali follow..  21  66...IVGARLYYVIFQWSYYSQHPSQIIAMWD.......... 93
3 -3.660[C] KOG3453 Cytochrome c  ali follow..  58SAANKSMAVNWEEKTLYDYLLNPKKYIPGTKMVFPGLKKPQ 98
4 -3.640[S] KOG4536 Predicted membrane protein  ali follow..  10  284...FFQEEDLNLENVYYSEMKDAGFFDADWE.......... 311
5 -3.580[S] COG3228 Uncharacterized protein conserved in bacteria  ali follow..  215DAYAASDPAECFAVLSEYFFSAPELFAPRFPSLWQRFC... 252
6 -3.310[S] COG2035 Predicted membrane protein  ali follow..  11  23...ISGGVLAAILGIYERMIGFLAHPFKDFKENVLYF.... 56
7 -3.280[H] COG4145 Na+/panthothenate symporter  ali follow..  17  337DAQLIQSSSIFVKDLYLSAKPEAAKNEKK............ 365
8 -3.250[P] KOG4195 Transient receptor potential-related channel 7  ali follow..  27  186............KELYRGYVDDPRNTDNAW........... 203
9 -3.050[A] KOG3801 Uncharacterized conserved protein BCN92  ali follow..  2.....SVSKQHVVRLYRNILKTSKLFPYTYREYTIR..... 32
10 -2.980[S] KOG4706 Uncharacterized conserved protein  ali follow..  18  111...LSRDLIDYVRYMVENHGEDYKAMARDEKNYYQ...... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.