current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF06021.11; F7BVP0_HORSE/2-206; Aralkyl acyl-CoA:amino acid N-acyltransferase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
# Score Template Links and tools%idFirst MFPLQGVQMLQTLEKSLRKSLPVSLKVYGAVFHMTHGNPFKLKALVDKWPDFNAVVIRPEEQEMTDDLDHYTNTYQIYSKDLKNCQEFLSSPEVINWKQHLQIQSSQSSLNEVIQNLAAMKSFKVKQTQCILYMTPEMAKKLAPSLLDGKNLSPDDGKPTDINQEMFRLSSLDVTHAALVNKFWHFGGNERSQRFIERCIRNFPNLast
1 -84.700PF06021.11; F7BVP0_HORSE/2-206; Aralkyl acyl-CoA:amino acid N-acyltransferase  ali  100  1MFPLQGVQMLQTLEKSLRKSLPVSLKVYGAVFHMTHGNPFKLKALVDKWPDFNAVVIRPEEQEMTDDLDHYTNTYQIYSKDLKNCQEFLSSPEVINWKQHLQIQSSQSSLNEVIQNLAAMKSFKVKQTQCILYMTPEMAKKLAPSLLDGKNLSPDDGKPTDINQEMFRLSSLDVTHAALVNKFWHFGGNERSQRFIERCIRNFPN 205
2 -30.400PF18713.1; B4JWR6_DROGR/9-138; Domain of unknown function (DUF5645 topsan)  ali follow..  1ILRPLSDSEVDELMQLYSDKYGVLNFHYLLLYNQRKWDHQLDAAGIGDFRRYGTYVSLHQDI------VQSVSFFTWQPIEPVELFACLEQTQYIQWSKGALLTNVNLGFCERVKEL........................................................................................ 130
3 -7.680PF12746.7; R6QM07_9FIRM/12-250; GNAT acetyltransferase  ali follow..  1.............KKLFGD---QETLIWSCLQKVM-------DIYVDNASDPQSAMAV-----------LGDFCFFAGNAEEDIVSFKPENC-----QDFIIMVPQSEEWAELIVKNYGDRAKPATRYAI--------------KKEQNIFDKDTLRSAVNSLKPGYILRMIDADLFALCRSSTWCQDLVSQFRDYEMYKKL... 152
4 -7.120PF06957.11; E9GA08_DAPPU/816-1224; Coatomer (COPI) alpha subunit C-terminus  ali follow..  10  113....ASAGSYESAFRLLHDQI--GVVNFAPFKPLFTAAFAKSRTMFAGLPNLPSLAAYPQRNWREVAASSKVHGLPALGVRLADLAQRLQI---YQLTTAGKFNEAVDRFRLLLLNVPNKEEVRKAQELIAICREYIVGLSMEAARKDLPKESLEDQKRSCEMAAYFTHSELQPIHQILLNLSFKLKNFRTAASFARRLLELGPK 319
5 -7.040PF13590.6; F8EJN4_RUNSL/24-181; Domain of unknown function (DUF4136 topsan)  ali follow..  32.........................................................................................................ATQNVEAVVDNALLNKGLRKDESDPDMLIGYHFFVEQKTRTVTDPP-GWGRTRTETYQDGTLVVDIVDARSKKLV---WPSNITDRLPKEVDKILEKYPG 158
6 -6.170PF14567.6; A6X428_OCHA4/5-137; SMI1-KNR4 cell-wall  ali follow..  22....PDDALIHKYESATGFQFSED---YKEFLKNVSNAFVGYLSPLILNEEMGGVYGELLTTIQQARSVGLPDNWLPICEDNGDYYCIAPDGLIRFWSHDGPSDESWPNLATWADEV........................................................................................ 131
7 -5.920PF10062.9; F6AFN0_PSEF1/414-534; Predicted secreted protein (DUF2300 topsan)  ali follow..  1............................................................................................DRLAWSQAVEQANSGLRYDAILARAFPRATLSRWDKPVAACQPLAAAEQWLRKQRRDWRPRLDMEPGYEEIQQRIFVRGFFSLQDRLD-----------THEYLHLAFVAHPN 121
8 -5.850PF04379.14; G2J5P7_PSEUL/18-104; ApaG domain  ali follow..  15  17......................................................................................................................................................................IRLTNSGTKTAQLISRHWFITEADGKVQEVR-VVGENP. 56
9 -5.820PF06824.11; U7PYZ2_SPOS1/83-525; Metal-independent alpha-mannosidase (GH125)  ali follow..  10  2..........VDMARLFENAFPST------TDTTVKFHTNGTD--------------GKVSEAVRAKIKAASGGAYDDGKWEGAQSFVITGDIIAEWLRDQPLAKTDPAVYNLILGAINTQSEYVIESPYCNAFQPPPISGLRPSHNGQDDKVHPAFEPSFVFECKYELDSL----AHFLALGNDFHDHTGSTDYLNR....... 173
10 -5.630PF00041.21; KALM_CHICK/544-641; Fibronectin type III domain  ali follow..  10  1.................................................................................................................................................................AKPENLSASFIVQEGNITGHFSWKISKAVLHQPMTGFQVT.... 40

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.