current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF11266.8; Q8DJB4_THEEB/11-228; Long-chain fatty aldehyde decarbonylase, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst DYHSDRYKDAYSRINAIVIEGEQEAHDNYIDLAKLLPQHQEELTRLAKMEARHKKGFEACGRNLSVTPDMEFAKAFFEKLRANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMADPFARKITESVVKDEYSHLNFGEIWLKEHFESVKGELEEANRANLPLVWKMLNQVEADAKVLGMEKDALVEDFMIQYSGALENIGFTTREIMKMSVYGLLast
1 -80.000PF11266.8; Q8DJB4_THEEB/11-228; Long-chain fatty aldehyde decarbonylase  ali  100  1DYHSDRYKDAYSRINAIVIEGEQEAHDNYIDLAKLLPQHQEELTRLAKMEARHKKGFEACGRNLSVTPDMEFAKAFFEKLRANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMADPFARKITESVVKDEYSHLNFGEIWLKEHFESVKGELEEANRANLPLVWKMLNQVEADAKVLGMEKDALVEDFMIQYSGALENIGFTTREIMKMSVYGL 218
2 -41.300PF11583.8; G0G4P5_AMYMS/7-282; P-aminobenzoate N-oxygenase AurF  ali follow..  11  53DRLTPEQRIELGKVATTGLWFEILLMQMLLKEVYEQDAHAQFALTEIADECRHSTMFARMASRIGCP-----AYGPVPWLRRLAKLMPTISYGPARYGAVLVAEEVLDRLQREQMTDGVQPLVRMVNRIHVLEEARHVTFAREEVTRGMAKLSKAEIGYQQFIIAVISYFVTRA-DVYKAVGIRPRDGVEAALNNPHWQLQESG.............. 276
3 -38.700PF04305.14; C1MSR4_MICPC/21-274; Protein of unknown function (DUF455 topsan)  ali follow..  16  57RLGKGGSPESRVAILHSLAHIESWAIDLSWDAIARFGKFFEDFLAVAADEARHFSLLAARLVELGSSYGALTAHD---------SATETRDSLEARLVIEHCVHEARGLDVLPGTIAKFDPSADLLEHVIYPEEITHCAAGVRWFTYLQNRMGGALVRFHVIVRKHFKGILKPPFND--------------------EARSRAGFQREWYE....... 254
4 -37.600PF00268.21; RIR2_SHV21/5-277; Ribonucleotide reductase, small chain  ali follow..  12  39DMLNERDLEFYKFLFTFLGMAEKLVNINIEDLLSQFHDISHYYAEQMAMENIHGKVYANILNMLFKNNITEMNDSALQEKLRWLNGRVTEASDKAEKILLFLLVEGIFFSIGLFRVRGIMNGICLANDYIARDEMLHTSAAALLYNTMTKSSERPSEDWIYKLFREAVEVEFKFIAAKGVSLVNVHEIRQFLQATADRILESINLNP........... 262
5 -36.500PF02332.18; G7ZAS0_AZOL4/60-290; Methane/Phenol/Toluene Hydroxylase  ali follow..  63QRFDKAWVTVLQNHVGAFKHAEYGLGTALMRAQRYGYMVNNAILTNASYKLRFAQDLTLYLAEVGSDIGGFLDDPIWQPCREAVEHIRAATDFLEQYFAVNLVFEPLVGELFQVAAAQNDFSTPSVISAAEADYERNLANAVELFALLLRD................................................................... 230
6 -36.500PF05138.12; Q5P3I7_AROAE/1-255; Phenylacetic acid catabolic protein  ali follow..  11  2..TQQMTSPEHIEYVLRLGDNALILGQRLSEWCGHAPVLEEDMANMSLDLIGQARMLLTHAGRLEGDEDQLAFLRTEPNYRNLTLCELPNQDFAR-TMVRNFLYSSFQKLLWERLMTSSDAELAAIAAKSIKEARYHAQHAGDWVIRLGAESYARAQGALDYLWPYTAEFFVATPVDAAGVGPAWSELETAWEALAMPVLAEATLTVPARTPFRSYG. 227
7 -23.500PF02915.17; O26850_METTH/9-145; Rubrerythrin  ali follow..  14  3..............LTKAFIGESQARNRYTFYAKIAEQISEIFLTTADNEREHAKWLFRLINDLKKEVGEDLSSIVVDA-EAPLTLGTTDENLIAAIEGEHYENSEMYPEFADVAEEEGYPEIAKRLRAIAEAEKHHEERYRKLL......................................................................... 137
8 -20.900PF03405.14; E1ZCJ2_CHLVA/69-399; Fatty acid desaturase  ali follow..  11  54KEVPDD----YFVCLVGDMITEEALPTYMAMLNTLDGPWGRWTRQWVAEENRHGDLMNKYCWLSGRVDLRQVEVTIQNLIGSGMDPKTENNPY--LGFIYTSFQERATKVSHGNTARMADEVLGKVCGAIASDESRHEIAYTRIVDEFFRQDPN---NAMLCFADMMRKQIVMPAHLMDDGKHGILNGGRNLFTDFSEVAERLGVQASDYCDIMEHLV 277
9 -19.400PF06175.11; Q8CX43_SHEON/3-250; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)  ali follow..  11  82.............EQFLARDVKKNELVAVLQPNQHFSDLIPPLIRLIKEEFHHFEQVLELMHARQIPYRNIRAGRYAKGMMSHVTT-HEKNILRDKLIVGAYI-EARSCERFAKLAPYLDAELSKFYVSLLRSEARHFEDYLKLAQLVSSEDISERVAYFGEREAELIM................................................. 238
10 -18.900PF05067.12; Q9KAU6_BACHD/1-281; Manganese containing catalase  ali follow..  13  15ERPDPVYAKKLQEILG--QFGEISVALQYL-NTRGDGKYRDLLMDTGTEELAHVEMLATMIARLLDGAPVGDQEAAAKN-----ADYIIASGNLLADFRMNLTAESQGRLQAVRLYEMTDPGVRDMLSFLIARDRMHQNQWYAAICELEEK................................................................... 196
11 -17.900PF09968.9; A6LNR3_THEM4/28-188; Uncharacterized protein domain (DUF2202 topsan)  ali follow..  14  2...........TESIMQMRKEEKLARDVYLVFYDLWG--IRVFSNIAGAEQQHMDAVLTLIKKYDSNDPIKVDEREDENLQALYNQLVEQGS-LEDALIVGATIEDLDIYDLEEFLKITNQDIEFVYKNLIKGSENHMRAFVSQLSRF...................................................................... 141
12 -17.600PF11251.8; C7PJT1_CHIPD/18-247; Protein of unknown function (DUF3050 topsan)  ali follow..  11.....QRMDDIRAFMQYHVFAVWDFMSLLKSLQRNLTATRFLINEIVTGELSHFELYLQAMEQVGADTSGNGLPPAVRGFVKHTFDLIANEPVHVQAAVFTFGREDLIPDMFLALVNDLSLFKYYLERHIEVDGDHHSHLGMEMVQELCGNDPQKWEEAAQASRAAL................................................... 220
13 -16.800PF14518.6; A0QTA7_MYCS2/140-317; Iron-containing redox enzyme  ali follow..  1...........REYFVHRSLYHLKEGDPHAWLIPRISQAKASFVAIEYDEYLHQQLFADLMEAADLDTTYLGYIGHVPALVNLMSMFGLHRKLRGAAAGHFAATEITSSPGSQRLTAALPEPCVRFYAEHVEADAVHEQVVRLNVIGDLVEREPELDADVVFGIRAFDALED.............................................. 178
14 -15.700PF03070.16; Q9HJM8_THEAC/69-287; TENA/THI-4/PQQC family  ali follow..  19EAMQKPTVPVLLGYVIEHRFFLKNWIRTLSMVIHSTTDAFEYEVENVATEYSHLELLLRMGEALGMSRKRIMEYSPLPETSQAIEVWISNRYSWIDTMGAMHVLELVADRTLVDDGSPIPEAVKNFLMEGYEADVGHAGEALKIVQAATMD-DLTTRSIMLRSMDAFYVYLNARMRR......................................... 218
15 -15.400PF03232.13; H0VHI5_CAVPO/48-217; Ubiquinone biosynthesis protein COQ7  ali follow..  16  1.........AVDRIIRVDHAGEYGADRILAMAVLGRTSVGPVIQKMWDQEKAHLKKFSELMVAFRVRPTALMPLWNVMGFALGAGTALLGKE---GAMACTVAVEETIAHHYNNQIRMKYEELLQLIKTIRDEELEHHDTGLY........................................................................... 140
16 -15.200PF13794.6; Q9FBJ1_STRCO/44-228; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)-like  ali follow..  18  1....PQYRAAVVDLLGALAYGELAAFERLAEDAKLAPTLKAELAKMASAEFHHFERLRDRLAEIGEEPTGAM--EPFVAAYDGFHKQTDPSDWLEGLV-KAYVGDSIASDFYREVAARLDTDTRELVLAVLDDTG-HAGFAVEKVRAAIDADPRVGGRLARRLMGEALSQSQRVVADRDALS.................................... 179
17 -15.000PF13668.6; Q11V37_CYTH3/38-167; Ferritin-like domain  ali follow..  11  3...........TDTLNYALTLEYLEEAFYVQGLAKSSADMTIFNQIKKHESAHVVFLKNVLGSAANPSPAFDFGTAFDSYAN--------------FLATAQALEDTGVRAYKGQAGNTNKVALTAALQIHSVEARHASE.............................................................................. 123
18 -14.700PF12981.7; B2IZC5_NOSP7/4-227; Domain of Unknown Function with PDB structure (DUF3865 topsan)  ali follow..  11  27QMLSQASFAQIAYVMQQYSIFPKELVGFTELARRKALGVAQELQENIDEEMSHYTLLADGLEELGVAVKNTMPSVATSKLLRTVLSLFDRQVD--YVLGATYAIEATSIPELTLIVKLVEWLHEGAIPHLDEWEIEHEAGLRTSVAAYIQPEEGEFAAGFRAMIDAMQVWWQELAQE......................................... 224
19 -14.500PF10118.9; W5TCA2_9NOCA/20-279; Predicted metal-dependent hydrolase  ali follow..  13  19...SEPIASHVFNSLNLLLEGERMFIETFSEALPLIEKLREQVIGFMGQEAMHAETHNDSVQQV-FRAHGVDVDSYARQMEYVFRKALGPRAGQDARLGFIATLEHFFAFLGDWIINAAAPNMLDLYRWHGAEEVEHRFVAHDVATYFDVG................................................................... 183
20 -14.000PF14530.6; C6WDL2_ACTMD/9-146; Domain of unknown function (DUF4439 topsan)  ali follow..  11  1.............AVQVGLGAEHAAVWTYGLVSAFLPAQEAVVAEGANAHRARRDTTERWLRDAGQQPKPA---------AAAYLPPEGVQDAASSIAALVAVEADCCAAWRGVLERTDDNALRTTALTALTESAVRGT............................................................................... 118
21 -11.100PF05974.12; Q3J1S1_RHOS4/10-166; Domain of unknown function (DUF892 topsan)  ali follow..  13  3.......DDLYTHMLQDIYYAEQQIEKALPKMIEKAAGLREGFEHHLDETRTHVSRLERVFALLGQDAKGPAIDGIIKEANEVAGDIAEQDVLDAALAAAAQAVEHYEMTRYGTLIAWSKPEVASILEQTLSEEKA------MKLTKLAEA................................................................... 151
22 -10.300PF12902.7; A4FHP6_SACEN/30-243; Ferritin-like  ali follow..  12  1..............LQAAMQIELTTIPLYMTAMYSIEEAQLVIRSVVLEEMLHLTLAANLVNALGGNPR..................................................................................................................................................... 60
23 -9.210PF01786.17; V2XMG8_MONRO/89-321; Alternative oxidase  ali follow..  13  71......SRILFLESIAGVMVAATMRHLTSLRLMRRDNGWIHTCLEEAENERMHLMTFMTLRKPISPRICHRFVGHLEEEAVVTYTRCIKDIEAGYVPEWSDMPAPKIAIDYWRLPADAK---LLDVIYAVRSDETTHRF............................................................................... 226

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.