current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF13451.6; R5B1M6_9CLOT/3-50; Probable zinc-ribbon domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst QDKTLVCKDCGAEFVFTAGEQEFYAEKGFQNEPIRCKACRNARKSQRSLast
1 -26.200PF13451.6; R5B1M6_9CLOT/3-50; Probable zinc-ribbon domain  ali  100  1QDKTLVCKDCGAEFVFTAGEQEFYAEKGFQNEPIRCKACRNARKSQRS 48
2 -8.170PF05605.12; B9SAX0_RICCO/49-102; Drought induced 19 protein (Di19), zinc-binding  ali follow..  17  1..AEYPCPFCIEDFDLVELCSHIDDDHPFESKPGICPVCATR...... 40
3 -8.070PF05280.11; Q63PR3_BURPS/1-173; Flagellar transcriptional activator (FlhC)  ali follow..  23  136.....PCTRCGGHFVAHAHDPH---------HGYVCGLCQPPSRAGKT 169
4 -7.900PF18547.1; R4W871_9EURY/226-277; Halobacterial output domain 2  ali follow..  14  4.....RCSECHLDWGTRHGDGLGKGYDQLGAFVWKCTRC......... 37
5 -7.290PF10071.9; Y1292_HAEIN/1-260; Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310 topsan)  ali follow..  20  220SEKSRCCPSCGANWALKDAIFDTFH---------KCDTCRLVSNLSWN 259
6 -6.980PF09788.9; T55BB_DANRE/3-255; Transmembrane protein 55A  ali follow..  22  154...RVSCGHCAKTFLWTEFTDR---------TLARCPHCRKVSSIGQR 189
7 -6.720PF14353.6; R6EE02_9BACE/9-141; CpXC protein  ali follow..  18  1....VTCSQCGKEH-----DIQTYPNINVKESPETCPDCGQVNLAPYQ 52
8 -6.650PF14205.6; D9R2S4_CLOSW/4-57; Cysteine-rich KTR  ali follow..  24  4....LLCPICGNK-----TRLKIREDTKLENFPLYCPKCKQE...... 36
9 -6.640PF14733.6; Q4UIX2_THEAN/453-540; AP2-coincident C-terminal  ali follow..  20  7.........CKEALLFMLYELEALVELDIPIPPISKSECKRGINFHIN 45
10 -6.310PF05180.12; S2JAB1_MUCC1/59-122; DNL zinc finger  ali follow..  19  2..IGFTCKVCNERSHHTMSKHSYTKGVVL----IQCPGCKNRHLIADN 43

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.