current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF14869.6; R6N218_9BACE/33-159; Domain of unknown function (DUF4488 topsan), from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst LNGVWQMCFYRSSSPDVVGELKTSNSLKILSDDGRFTNLVMMQSGAIIIGYGTYKQNSESVYTEYVEKNLHLPQLNGDKNEMHFELKEDGNLMFVKYYLTVDRDGNKIDSWCHEIWKRVVMPSAYPELast
1 -71.100PF14869.6; R6N218_9BACE/33-159; Domain of unknown function (DUF4488 topsan)  ali  100  1LNGVWQMCFYRSSSPDVVGELKTSNSLKILSDDGRFTNLVMMQSGAIIIGYGTYKQNSESVYTEYVEKNLHLPQLNGDKNEMHFELKEDGNLMFVKYYLTVDRDGNKIDSWCHEIWKRVVMPSAYPE 127
2 -24.500PF13924.6; Q0CAL3_ASPTN/76-218; Lipocalin-like domain  ali follow..  12  1.IGSWKLVKFVSEPVNGTEPCRGAQGFIIYTSDGHMPVHLMRPGKHYLAYAGRFDVRETALLRHHIL-VSSYPDWLGTVQERRALLEGDVLRLE----TVNILEKEGFQQRWVLTWKKT........ 143
3 -12.100PF16395.5; R5P1H9_9BACT/21-153; Domain of unknown function (DUF5004 topsan)  ali follow..  11  17LIGTWNVKSGTKKEMDITPYFNFDSYKVTFNEDKSFSIESSSMTNFVGLLSGTWSY-DDAEAPLLINLTEGTVSSQGTNLRIKFIRKSEDKAIVSY............................... 128
4 -11.100PF16139.5; D6D1P5_9BACE/22-161; Domain of unknown function (DUF4847 topsan)  ali follow..  10  11TGKTWKLTYINLKDKGGWMNGFSEKSIKILNENQESYTITFTGTEEDNDLTGTWSANGKNNEFHASVTNVNENDDLAKEFASSYIGDDNGLFLY................................. 124
5 -10.700PF16585.5; R6X4D7_9BACT/16-151; Lipocalin-like domain  ali follow..  16LAGYWHLERVDTLQTGGVKDMSRDRVFWAVQGK---LLMVRNTVEPYTGFFFRFDNSGDYLILSNPHSNGGHQTINSLEEHFHKQLTSSRLTLS................................. 126
6 -9.850PF10681.9; ROT1_YARLI/31-243; Chaperone for protein-folding within the ER, fungal  ali follow..  12  1LEGTWSSKSGADPIDELLLEPTLPGISYSFTKDGFFEEAIYQPTGVLIFQHGTYNISDNGTLTLE-DGRQLLSDPCKQEENAVYSRYNQTEKFKRFSVYVDPYHGRYNGAPMPPMYLAYRPAMMLP. 154
7 -9.360PF18692.1; R6DJM9_9BACE/35-128; Family of unknown function (DUF5640 topsan)  ali follow..  13  3IIGTW------------STGTESVHKYLKFENDGTGYYALLNGADFATNYLFTYKISANNINIV-ITYSDGGNKLNGQERVWECLFSKDVLKIT................................. 83
8 -9.040PF08768.11; D1A4L3_THECD/8-159; Domain of unknown function (DUF1794 topsan)  ali follow..  11  8LLGEWEGAGVGGYPTIDSFRFGQEISFTHPQPNNEVEVTLAHPTGVVEIYIG--TVAFNRVELRTDVVARTSSAKEVAAGHRLYGLIGEDLGWAY----DMAAMGQSLQSHVSAQLKR......... 152
9 -8.990PF14921.6; I3JII9_ORENI/63-285; Adenomatosis polyposis coli down-regulated 1  ali follow..  12  18LDGTWVSIRCEVRPGPEFLTRSYT-----FHPNRHFQALQHEDPSYSLLVRGKIRLRQASWITHEAEHHLSKVAIVVHSLAAKQRLAS....................................... 110
10 -8.790PF07617.11; L0DJG2_SINAD/4-157; Protein of unknown function (DUF1579 topsan)  ali follow..  10  12LVGEWTSEFECRMGPDEPTMKSQGVEVVRSLGGLWIVGEGEGEAPDGNTSKTVMSLGYDPRIKRYVGTFIASMM--THLWVYNGSLDAAGKVLTLDTEGPDFSGQKLAK--YKDIIEFVDDDH.... 130

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.