current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: PF15616.6; Q5NWS3_AROAE/221-349; TerY-C metal binding domain, from PfamA32U

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst DEDFVIVAGKCQSTKLPYLMKFERIGQRFSTQELSVNADRYNLVGVFPAEKDYYELSDPRAMARTINTDALIGAPGCPHCGNRFGLAMCGCGQIFCVSGTGEATCPGCNQTVVMGESDGEGFDISRARGLast
1 -65.400PF15616.6; Q5NWS3_AROAE/221-349; TerY-C metal binding domain  ali  100  1DEDFVIVAGKCQSTKLPYLMKFERIGQRFSTQELSVNADRYNLVGVFPAEKDYYELSDPRAMARTINTDALIGAPGCPHCGNRFGLAMCGCGQIFCVSGTGEATCPGCNQTVVMGESDGEGFDISRARG 129
2 -11.700PF05290.11; Q0ILB1_NPVLS/143-285; Baculovirus immediate-early protein (IE-0)  ali follow..  16  56.................................................QEQLDCVQRITKTVQVMNVFLETPLYECGICEATFLKPNECCGFKICNKSAVHPVCPVCKTS.................. 132
3 -11.500PF09416.10; I1BQX9_RHIO9/91-242; RNA helicase (UPF2 interacting domain)  ali follow..  27  2...........................................................................ACKYCGPASVVKCVTCDRWFCNSGDTILECYNCGCRNVFL.............. 73
4 -11.100PF02318.16; H3DKF6_TETNG/7-124; FYVE-type zinc finger  ali follow..  12  29................................................LGDLKTKIQKEDTKRELLGNQSRLTESYCIRCLQPFKFLCLDCQLHIC-KREQGWVCDPCHMARVLKIGTLEWY....... 114
5 -10.600PF14353.6; R6EE02_9BACE/9-141; CpXC protein  ali follow..  20  3............................................................................CSQCGKEHDIQT-ELKARIKDGTLFLWTCPDCGQVNLAP.............. 50
6 -10.200PF18551.1; A0A0W0YXK1_LEGSP/105-294; Thaumarchaeal output domain 1  ali follow..  16  50...............................................SDFDGWRFLQDLVMPDLLTPGPLLDEIQTCSACDSGLLNSCPSCHSINCFLRQERLVCSRCNTRLRTLGVD........... 142
7 -10.200PF15135.6; F7F5S5_MONDO/19-277; Uncharacterised protein UPF0515 topsan  ali follow..  20  120............................................................................CRKCKVKAEFQCLQCGHTF--QMGNPSPCYSCGNP.................. 168
8 -9.920PF06044.12; T2D1_STRR6/1-181; Dam-replacing family  ali follow..  16  7.................................................LELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFENNRPVA------DFYCNHCSEEFELKSKKGN......... 71
9 -9.650PF10083.9; Q3A032_PELCD/5-158; Uncharacterized protein conserved in bacteria (DUF2321 topsan)  ali follow..  22  29............................................................................CSDCGEETITACPSCGS----NFHAPSYCFNCGSP.................. 74
10 -9.360PF09334.11; SYM_CHLTE/8-409; tRNA synthetases class I (M)  ali follow..  13  47DEHGVPITITADKEGAKCGISFDYYGRTSGPVHHQTAREFFEIEKKGIFVKKTEKQFFDPKAGRFLSDRYITG--TCPVCKTPGA-QCEQCGTHLSPTELIDPKSKLSDATPELRETLHWYFPLGR... 191
11 -9.350PF05458.12; SIVA_HUMAN/1-175; Cd27 binding protein (Siva)  ali follow..  30  142............................................................................CWGCGS---VACTLCGLVDCSDMYEKVLCTSCA.................... 171
12 -9.220PF07191.12; C4LC42_TOLAT/5-72; zinc-ribbons  ali follow..  20  3............................................................................CPSCQRFATTTCVHCAK----QFNLVAYCPTCHAELERLQACGA......... 48
13 -9.010PF05129.13; D5G8G1_TUBMM/90-168; Transcription elongation factor Elf1 like  ali follow..  21  3......................................................RKRSTRKPNVFKKKEPLSTTFMCLFCNNQDTVAC----VLDKKAGIGSLSCRACGQRFKMN.............. 59

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.