current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16759004|ref|NP_454621.1|(removed signalp:1-23) hypothetical protein (STY0011) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NDHKILGVIAMPRNETNDLALKIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNKRCVSKITFSGHTVNSSDMARLKVIGDDLast
1 -6.450sp|Q8N5W9|F101B_HUMAN Protein FAM101B OS=Homo sapiens GN=FAM101B PE=1 SV=1 (Range: 80-214)  ali follow..  12GEGVEFDPLPPKEVRYTSLVKYDSERHFIDDVQLPLGLAVASCSQTVTCVPNGTWRKAEVRFEPRHRPTRFLSTTIVYPKYPKAVYTTTLDYNCRKTLRRFLSSVELEAAE 124
2 -5.970sp|Q8NA69|CS045_HUMAN Uncharacterized protein C19orf45 OS=Homo sapiens GN=C19orf45 PE=2 SV=2 (Range: 233-330)  ali follow..  1....ELGDCKISYGSTCSEQKQAYRPQDLPEDRYDKAQATAHIHCVNI--RPGDGLFRDRTTKAEHFYAREPEPFVLHHDQTPESHILK...................... 83
3 -5.890sp|Q6ZTI6|F101A_HUMAN Protein FAM101A OS=Homo sapiens GN=FAM101A PE=2 SV=3 (Range: 73-216)  ali follow..  20GESIKVNPEPTHEIRCNSEVKYASEKHFQDKVFYAPVPTVTAYSETIVAAPNCTWRRSQLTLEPRPRALRFRSTTIIFPKHARSTFRTTLHCSLGRPSRWFTASVQLQLCQ 132
4 -5.560sp|O00534|VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens GN=VWA5A PE=2 SV=2 (Range: 464-553)  ali follow..  13  3..........................................VEDVSLSWHLPPGLSAKMQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKS 89
5 -5.080sp|O94985|CSTN1_HUMAN Calsyntenin-1 OS=Homo sapiens GN=CLSTN1 PE=1 SV=1 (Range: 711-815)  ali follow..  2...................................EIVHDLDTCEVTVEGEELNHEQESLEVDMARLQQSSELGMTFTGVDT-EEVLHLLRYRNWHARSLLDRKFKL.... 82
6 -5.030sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=1 (Range: 2931-2998)  ali follow..  7SEWREVEEIPFEFEARGKLRHRHTHDLRIHQLQVRVNGSPVSVDKVGTFFRYAA......................................................... 67
7 -4.870sp|Q9BQT9|CSTN3_HUMAN Calsyntenin-3 OS=Homo sapiens GN=CLSTN3 PE=1 SV=1 (Range: 699-803)  ali follow..  2...................................EIVHNLDGCEISLVGDDLDPERESLLLDTTSLQQNTSAYLTIAGVES-EEILRQARYRLRHGAALYTRKFRL.... 82
8 -4.850sp|Q5T4S7|UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens GN=UBR4 PE=1 SV=1 (Range: 2288-2432)  ali follow..  26......NAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIRTMQLNLSRSRWFDFP-REEALQADKKLNLFIGASVDPAGVTVKIYGKT 139
9 -4.840sp|A2VDJ0|T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens GN=KIAA0922 PE=1 SV=2 (Range: 765-899)  ali follow..  13  1.............................................ITKNFKVENIGPLPITVSSLKINGYNCQGYGFEVLDCHQFSLDSIVFTPDFTSSWVIRDLSLVTAA 73
10 -4.770sp|Q8TEM1|PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 (Range: 1536-1808)  ali follow..  162.......EILLSNHYTSSEIRVFGAPEVLENLEVKSGSPAVLAFAKEKSFGWPSFITYTVGVLDPAAGSQGPLSTTLTFSSPVTNQAIAIPVTVAFVVDRRGPG....... 258

FFAS is supported by the NIH grant R01-GM087218-01
1 2 3 3 5 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;