current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: gi|16763399|ref|NP_459014.1| hypothetical protein (STM0009) [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] (Range: 1-188), from S.typhimurium

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst MGNTKLANPAPLGLMGFGMTTILLNLHNAGFFALDGIILAMGIFYGGIAQIFAGLLEYKKGNTFGLTAFTSYGSFWLTLVAILLMPKMGLTDAPDAQLLGAYLGLWGVFTLFMFFGTLKAARALQFVFLSLTVLFALLAVGNITGNEATIHIAGWVGLVCGASAIYLAMGEVLNEQFGRTILPIGEAHLast
1 -91.400[S] COG1584 Predicted membrane protein  ali follow..  65  17..KDLSANPAPLGLMGFGMTTVLLNIHNAGFYPLGAVILSMGIFYGGLGQVIAGIEEWKKGNTFGATAFTSYGLFWLTLVVIVLLPKFGDNFALTPTDFAAYLFLWGLFTLYMFIGTLKATRALQVVFLSLTILFFLLAAGNYMGNPAIIKIAGYEGIFVGFSAIYAAMGQVLNEAYGKKIVPL.... 201
2 -8.400[O] KOG2292 Oligosaccharyltransferase, STT3 subunit  ali follow..  12  80..........PLGLMITSGGIHWLLHVLNIPVHIRDICVFLAPIFSGLTSIST----YLLTKELWSAGAGLFAASFIAIVPGYI--SRSVAGSYDNEGIAIFAL---QFTYFLWVRSVKTGSVFWSAAAALSYFYMVSA--------------GGYVFIINLIPLHVFVLLIMGRYSPRLLTSY.... 241
3 -8.290[S] KOG2889 Predicted PRP38-like splicing factor  ali follow..  1MANRTEKAAKTVG--QFLVEKIIRQRIYDSMYWKEHCFALTAELVVDKGMDLRYIGGIYAGNIKPTPFLCALKMLQIQPDKDIVLEFIQQEEFKYIRALGAMYLRLT................................................................................. 110
4 -8.140[A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor  ali follow..  313LINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIMGGILSLFAIITRLQLPQEFITTTSHPFPI---SWHILARICNTPLNLITNTHFVILGSWW-----------AAAVQFLQAYGASKLLILIGEELARLRILLEAWQNNNMESFPEMS 537
5 -8.120[T] KOG2290 Rhomboid family proteins  ali follow..  19  656.....................................LWLSLFLHAGILHCLVSICEKLAGWHRIAIIYLLSGVTGNLASAIFLPYRAEVGPA------GSQFGILACLFVELFQSWQILARPWRAFFKLLAVVLFLFTFGLLPWIDNFAHISGFIGLFLSFA......................... 785
6 -7.880[R] COG1287 Uncharacterized membrane protein, required for N-linked glycosylation  ali follow..  10  85..........PLGLMVTSGIIFKVLHLLRINVNIRDVCVLLAPAFSGITAIAT----YYLARELKSDACGLLAAAFMGIAPGYT--SRSVAGSYDNEAIAITLL---MSTFALWIKAVKSGSSFWGACTGLLYFYMVTA--------------GGYVFITNMIPLHVFVLLLMGRYTSKLYI...... 244
7 -7.700[A] KOG4746 Small nuclear RNA activating complex (SNAPc), subunit SNAP43  ali follow..  13  4...................................GGASCLTPVYAGIRDDLNSFLRYLQFESVR---FFDYKVMFENRG---------------------------MVGLFTGRHNSAEIIEFNECLLVHCLPYMEECVCPGTPRSLKERLFGLYSL-------YTFYYIQQEKHVVKVRMDPDSSR 120
8 -7.570[C] KOG2189 Vacuolar H+-ATPase V0 sector, subunit a  ali follow..  15  408IATYREINPAPYGAIMLLAALFFILKEKQLEAARIKDEIFQTFFGGRYVIFLMGAFSIYTGNDVFSKSINTFGSSWYYLDDEKRSESQLILPPETAFDGNPYPIVWNLAE-LSFLNSMKMKMSVLFGIAQMTFGVLLSYQNFIYFKSDLDIKYMFIPQMIFLSSIFIYLCIQI............... 617
9 -7.030[S] KOG4556 Predicted membrane protein  ali follow..  7.............LSLLLATWTLLSIARLVFDLIGNLWVVVVFDFVQIVLLISGLFGATQKRRPLLYTLLSSNALSVTINVLIFIGVFGEISRPYLSAGLPYSSSFFLRFTPYCDAEFDVIRKKWVQKQCLI------------PFYSVEASQAILHIIFAIVTSIFSILVIVELRKKPIRSN..... 167
10 -6.880[S] COG5291 Predicted membrane protein  ali follow..  12  16.....MLRVPPITRYMTLLISAVALLVYVDAVSPYSLYFTSFLYFGTLDMFMHVVFLYRYSRMLEEGCVNTSEYFWLILVISSVLFAISNI-------YGISALGTSFSATITYIWTKRNPRAIVQIFGFISFPFILPGFMLLSRRSIS--IDDVLGIVVGHLFHYF-----------KDVYPRWGRD 199

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 9 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;