current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}, from SCOP206

Results of FFAS03 search in SCOP206
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
1 -53.300d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]}  ali model 3D-neighbors  100  1MDRVLSRADKERLLELLKLPRQLWGDFGRMQQAYKQQSLLLHPDKGGSHALMQELNSLWGTFKTEVYNLRMNLGGTGFQ 79
2 -38.200d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]}  ali model 3D-neighbors follow..  29  3.....MREESLQLMDLLGLERSAWGNIPLMRKAYLKKCKEFHPDKGGDEEKMKKMNTLYKKMEDGVKYAHQPDFGGFWD 76
3 -36.800d2o37a_ a.2.3.0 (A:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  17  1......MVKETKLYDLLGVSPSANEQE--LKKGYRKAALKYHPDKPGDTEKFKEISEAFEILNDPQKREIYDQYGLE.. 70
4 -34.600d2yuaa1 a.2.3.0 (A:8-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  17  8........SRTALYDLLGVPSTA--TQAQIKAAYYRQCFLYHPDRNSGAERFTRISQAYVVLGSATLRRKYDRGLLS.. 78
5 -34.100d2cuga1 a.2.3.0 (A:8-82) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  17  6......SALDFDPYRVLGVSRTA--SQADIKKAYKKLAREWHPDKNKDEDRFIQISKAYEILSNEEKRTNYDHYG.... 75
6 -33.700d3ucsc1 a.2.3.0 (C:2-73) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  14  1........ELKDYYAIMGVKPTD--DLKTIKTAYRRLARKYHPDVSKEEARFKEVAEAWEVLSDEQRRAEYDQMWQHRN 72
7 -32.800d1wjza1 a.2.3.1 (A:8-88) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  2...ALEQTLKKDWYSILGADPSA--NMSDLKQKYQKLILLYHPDKQSAMQKFIEIDQAWKILGNEETKKKYDL...... 79
8 -24.200d1iura1 a.2.3.1 (A:14-88) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  2.........LKEVTSVVEQAWKL--PESERKKIIRRLYLKWHPDKNPENEVFKHLQNEINRLE---KQAFLDQNADR.. 69
9 -19.400d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  20  2...........DYFTLFGLPARYQLDTQALSLRFQDLQRQYHPDKFASGSQAEQINQAWQTLRHPLMRAEY........ 70
10 -12.500d2qwob_ a.2.3.1 (B:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]}  ali model 3D-neighbors follow..  13  48...........................EQVKKVYRKAVLVVHPCKATGQPYEQYAKMIFMELNDAWSEFENQ....... 92
11 -11.600d3ag7a1 a.2.3.0 (A:551-650) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  28  50...........................NAVRKSYQRALLILHPDK--AEKVFELLQEAWDHFNTL.............. 98

FFAS is supported by the NIH grant R01-GM087218-01
1 2 2 2 5 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.