current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d2esna2 c.94.1.1 (A:92-303) Probable LysR-type transcriptional regulator PA0477 {Pseudomonas aeruginosa [TaxId: 287]}, from SCOP206

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
454 2.000e-75gi|594026347|gb|AHL74350.1| LysR family transcriptional regulator [Pseudomonas stutzeri]  clstr ali  28  90FDPSTTDRQFHVLTPDIGEINFLPKLLIHFAAHAPNARVKTVSMPKHAAADALESGAVDLALGYFPDLQ--KAGFFQQRLFCNEYVCIVRRDHPD