current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIKLast
1 -46.500[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  15  2.LDAQTIATVKATIPLL---VETGPKLTAHFYDRMFTHNPELKEIFNM------SNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMFNGQEVLDAWGKAYGVLANVF. 131
2 -23.700[C] KOG3378 Globins and related hemoproteins  ali follow..  18  258RITERQKHIFTETFPVI---FKEYKRNGLVLFAKYFSEFPHYKNIWPQFRSALLASNELANHCSVYMSGLKV.................................................................... 330
3 -8.150[R] COG2346 Truncated hemoglobins  ali follow..  10  33....................DATVRALTRRFYELM-DTLPEAARCRA------IHPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHM. 143
4 -6.750[A] COG5107 Pre-mRNA 3`-end processing (cleavage and polyadenylation) factor  ali follow..  43...........LSYFQLIQYLETQESYAKEVYEQFHNTFPFYSPAWTLQLKGELARDEFE-TVEKILAQCLSGKLENNDLSLWSTYLDYIRRKNNLITGGQEARAVIVKAFQLVMQKCIFEPKSSSFWNEYLNFLEQ... 170
5 -6.400[A] KOG1914 mRNA cleavage and polyadenylation factor I complex, subunit RNA14  ali follow..  1.MSGLSMRNPERAWLLLREHQSRPIDQERDFYESLVKQFPNSGRYWKAYIEHELRSKNFE----NVEKLFSRCLVSVLNIDLWKCYIHYVFETK---GQRDQYREEMAKAYDFALEKVGMDVQAYSIFTEYIAFLKK... 140
6 -5.820[S] COG4715 Uncharacterized conserved protein  ali follow..  506.....YEGLIEDAIATVSELSSYHSALIHRVMEAAISHKPDVITNARRRAEKIMDEGKAEYYAVEWLKKVRAAYIQSGRQADWSKYREKLIEIHARK-----------RKLMGMFKER...................... 610
7 -5.520[QI] KOG0157 Cytochrome P450 CYP4/CYP19/CYP26 subfamilies  ali follow..  10  265..NPSDDKFLRDTILAFVLAGRDTTASALTWFFWLLLENPQVTKIRQEINTSNGGQEKPSCEPMEYLNNLVYLHGALYEAMRLYPPVPFERMSPIKPDVLPSGHKVDSSMKILIFIYALGSEFKPERW............ 401
8 -5.390[S] KOG3077 Uncharacterized conserved protein  ali follow..  12  152NMGYFTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQ---RSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLE-FSRTINLDLSNYDEDGAWPVLLDEFVEWYK 287
9 -5.380[S] COG5592 Uncharacterized conserved protein  ali follow..  6ELLMVEHSAIRILSRVVYGKESLEAFEDFNEYLVKDHVEVEEKILFPVIVDFDWEDRK-HKLIETLAENMLKWKRSGNDDLLRMPLFYKTLTDHNLSE-EDQIFPRWKKLEAETRENALKEAMDI............... 142
10 -5.370[YU] KOG1992 Nuclear export receptor CSE1/CAS (importin beta superfamily)  ali follow..  2ELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESV-EGNQNYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDEPNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGREDF-PQKWPDLLTEMVNRFQ 139

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.