current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYHLast
1 -32.100IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  2..LTQEHINIIKSTIPLLESPALTQHFYQRMFSHNPELKHIFNM--------THQKTGRQSVALFEAIAAYAKHIDNLAALTSAVERI-AHKHTSFNIQPEHYQIVGHHLLETLRELAPDAFTQPVEEAWTAAYFFLAQVFIDREG 138
2 -31.200IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  2..LTEQEKDIIKQTVPLLKETEITSIFYPKMFKAHPELLNMFNQ--------TNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPV-AYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQAWAKAYGVIADVFIQIEK 138
3 -29.000IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  2..LDTQTIAIVKSTIPLLAAPKLTAHFYERMFKHHPELKNIFNM--------SNQSSGDQREALFNAICAYATNIENLAALLPTVERI-AQKHTSLNIQPEHYPIVGEHLIATLDELFSP--GQAVLDAWAKAYGVLADVFIQR.. 134
4 -7.010IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  21....DDRDLLLAPKWSFLSLSSFLKQKLLSLLRVYPPQDKLMWWSHCCDPEDILGQDPYHKGQATGLAFSVDPQCQSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLE 180
5 -6.620IDP02284 gene: grpE; heat shock protein GrpE [Coxiella burnetii RSA 493] CBU_1293 [Coxiella burnetii RSA 493]  ali follow..  10  70.............................QYLRAQAEMDNLRKRIEREKADIIKFGSKQLITDLLPVADSLIHGLESPASEDPQVKSMRD-------TLDLLHNTLAKHGVQVINPNPGDPFDPALHEAMSVQ-DTIIQVLQKGY. 188
6 -6.570IDP02504 gene: ung; uracil-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1578c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  2.............TWSDILAEEKQKPYFKQILDIFPTKENIFNAFKYTELDNLKQDPYHNYNQAHGLAFSVQKGVDSLQNIYKELARSIPEFKTPNHGYLVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISENKH 153
7 -5.860IDP00491 heat shock protein GrpE YPO1107 [Yersinia pestis CO92]  ali follow..  10  56.............................SLLRAKAEVENIRRRTELDVEKAHKFALERFSSELLPVIDNLERALDTADKTNTELISMI-----------EGVELTLKSLLDAVGKFTHVPFNPEVHQAMTML-NHVMMVMQKGY. 173
8 -5.800IDP01229 Protein grpE (HSP-70 cofactor) BA_4540 [Bacillus anthracis str. Ames]  ali follow..  14  52................................ETEGRTLRLQADFENYKRRVQMDKQAAEKYRAQSLVSDILPALDNFERAMQVEATDEQTKSLLQGM-----EMVHRQLLEALNEAVGKQFDPNEHQAIMQV-NAVVEEFQKGY. 172
9 -5.740IDP02360 gene: grpE; heat shock protein GrpE [Francisella tularensis subsp. tularensis SCHU S4] FTT1270c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  58................................QFKDEALRAKAEMENIRKRAERDVSNARKFGIEKFSKELLPVIDSIEQALKHEVKLEEAIAMKEGI-----ELTAKMLVDILKKNKGEKFDPNLHEAMAMI-NTIFDVFQKGY. 178
10 -5.650IDP01403 heat shock protein GrpE VC0854 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  56..................VSEERVKEQQDSVLRARAEVENMRRRSEQEVDKARKFALSRFAEELLPVIDNLERAIQAADGEVEAIKPLL-----------EGVELTHKTFVDTIAKFHGEVFNPEFHQAMSIQ-NTVMFVMQKGY. 184

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 9 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.