current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1ngka_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbO [TaxId: 1773]}, from SCOP207

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst KSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPFLast
1 -3.730PB047496 gi|150008556|ref|YP_001303299.1| hypothetical protein BDI_1942 [Parabacteroides distasonis ATCC 8503]gi|149936980|gb|ABR43677.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  69DNALKNVAGSLAATEA----------EKKMKEYCAKVGIVEGVFNYVTFTSALLKGTYSVSPEDKTVTLRYTVGNKKLTVSTLTAHVVLSGNELTLLFNADKLLKFLSTVSSISSNTTLKAINK.. 191
2 -3.360HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  35EDLQQAVGGDIEMTYPFDDEVGILLNGN----KFEGLPLNRALYDDHGQVYDAIAGTFLVVGLTEDDFT-------SLTPEQIEKFKEKYQSP................................. 117
3 -3.150PB001404 Q2S5L8_SALRD/1-256 PB001404; Pfam-B_1404;  ali follow..  10  132DTRYGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVPYFDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFN.............. 243
4 -3.090HGC00024 gi|162813637|dbj|BABA01031072.1|2.0 TMP01508;  ali follow..  99...SNTVATNSNLRWYWGNAYTQIAKYNTFLENITDCPMEESKKEQWS-------AEVKCLRAYFFLNLAFYYTDVPM-----------PLKTLSVDEANSISQTPQTEVYSQVKDLKTAIDLLP. 203
5 -2.890PB022697 Q5LAY4_BACFN/1-165 PB022697; Pfam-B_22697;  ali follow..  6DASLQKAAGEGMIQVFTDKYKEVIGGELTAETMPLLTGEQHSLLAYQIFRDEV-GGFCQLIQNGYGGYIFDNPFAKVMRLWGAEDFSKLVYKAKKIYDAHRHDLEKERT................. 118
6 -2.810PB004996 Q5NNS6_ZYMMO/1-150 PB004996; Pfam-B_4996;  ali follow..  12  5DVLFERLS---------SSFRRRFRLGVQEQQYLANKGMETILEHGKDFIAQRLANDGKQTPCKGHPVFLAQHATGTCCRGCIEKWHRI-GKSLSQEEQAYILDVIAHWLDLQKEVPPK....... 121
7 -2.780HGC00522 gi|163636101|dbj|BABG01000172.1|3.0 TMP00580;  ali follow..  34.QIWEDAGAKINLVGSLRTGLLMKHRDIDFHIYSSPLNLTDSFQAMARLAENPSIKRIECANLLHTAE-ACIEWHAWYQNEENELWQMDMIHIREGSRYDGYFEKVAQRISEIMTDEIRETI.... 153
8 -2.330PB002104 Q72PH8_LEPIC/1-220 PB002104; Pfam-B_2104;  ali follow..  1................MHNFKEKIQ--SKIRSRSCPFMQQNKFRKAIVAILMPMILVVSFGNCFGKFAIVKKNDGFNIGSGLLAKFIKTLVMYFPFSILYFVGFFFDLILFNLIEFWSG---NNPV 110
9 -2.290PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  17....KVVGNVEDFVSLTRVYFQSVIAVNLITNIRFLPDVANFKRLF---------------------KVATQGGKLGLAEKSASRKMLMQDYGISESFFKEIDTSIKKN................. 101
10 -2.280PB007843 JCVI_PEP_1096682172521 /source_dna_id=JCVI_ORF_1096682172520 /offset=0 /translation_table=11 /length=152 /full_length=152  ali follow..  6.....SISGRPGLFEVHTQTRTGVVATSLVDGKRINANARNQVSLLSEINIYGLEKEVPLQEVLTMIHTKEEGKQCSVKPKSPADELAYFFDVFQDYDEERVYPSDIKKIIQWYNILAEK...... 121

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.