current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d2gkma_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Mycobacterium tuberculosis, HbN [TaxId: 1773]}, from SCOP207

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst GLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSLast
1 -4.400PB027498 Q7MTK6_PORGI/1-146 PB027498; Pfam-B_27498;  ali follow..  11  73...........................................YYDDEELDRYAGV----------LPEEYNTEAVEEFEEILTLQEEEVPSWIRSLQ--MRQIQMPISIKEQALFIVSEHRIQ... 142
2 -3.330HGC01024 gi|162869036|dbj|BABB01000971.1|4.0 TMP01399;  ali follow..  10  17.FMVGCGKQVPENIIQP-------DRMENILYDYHLSISMGNNLSYSDNYQKEAYKNYVF--------------------EKHHITEAEFDSSMVWYTRHTEEL---ASLYKKLGERFRSEKKHM.. 110
3 -2.910HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  13  31.......PNELEDLQQAVGGDIEMTYPFDDEVGILLNGN----KFEGLPLNRALYDDHGQVYDAIAGTFLVVGLT---EDDFTSLTPEQIEKFKEKYQSP........................... 117
4 -2.820PB001025 Q1QFV3_NITHX/1-288 PB001025; Pfam-B_1025;  ali follow..  44.FVDLASRDAVDKTLQRLTKAEALRRIDRGLYDQPGFNKLTQKAANDLGLTDAVPAKIVVHTDARRRAIKLGNATITFRPTA-LVRDGESEQIQRKLAKLFEDPAVGPPLKADLAAGMTALPTWMLV 219
5 -2.650PB032818 Q5LA03_BACFN/1-211 PB032818; Pfam-B_32818;  ali follow..  13  2SIFANLFKKQADADAKVVGNVEDFVSLTRVYFQSVIAVNLITNIRFLPDVANFKRLFKVATQGGKLGLAE-KSASRKMLMQDYGISESFFKE----IDTSIKKNCRTQNDVQAYLFMYQGFSSDLM. 123
6 -2.630HGC00150 gi|162733542|dbj|BAAZ01030454.1|1.0 TMP01074;  ali follow..  2.LGITNVPDKKNYAIDELG-----AQAARNLYAGKANAQVVNYLLESPRFLDLTYILEQYFNDTVAAGYAAQNQLYTTISS---TRKTVKTEAGEQAARDIAHLRTSVYIENQFMLAVKEVKKEIGN 128
7 -2.540PB092941 Q45777_BACTN/1-139 PB092941; Pfam-B_92941;  ali follow..  14  1.MAKIQIKSEQITPF---GGIFCVMEEFDALLSNII-DSTLGPRTKTFGYQYSEIFRSLMCVYFCGG............................................................ 62
8 -2.450HGC00857 gi|162620543|dbj|BAAW01002606.1|2.0 TMP01139;  ali follow..  10  1..............MLNFHSKKV-MCIQQEIYARMIMYNFVQMITSHVVIVKKQRKHTYKA---------------------------NFSVATHMCRLFYREKTTSPNLETIIAKNLIPIRPD... 82
9 -2.350PB034180 _Gut.Meta.Jp.0112129_ gi|163310377|dbj|BABD01000320.1||2 (+ 509:1679~0 complete)  ali follow..  18  17...............................................................................YTAVQPSDSYFVNLSNKLYGACTLTTLPDIFRKKLGMYIAAYLEDQIS 64
10 -2.310PB008434 gi|121582878|ref|YP_973320.1| hypothetical protein Pnap_4296 [Polaromonas naphthalenivorans CJ2]gi|120596140|gb|ABM39578.1| conserved hypothetical protein [Polaromonas naphthalenivorans CJ2]  ali follow..  144AYKGSGRPDKETKLYQATGNAAIPHMWVDAFFGSNFTHPNFKEKDRLVKGVCPIDFWKAMTEK---PLPVFPEGRLVDLPLTVALLAPDLNQKLGNIDRA........................... 261

FFAS is supported by the NIH grant R01-GM087218-01
1 2 6 4 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Fragnostic: walking through protein structure space. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W249-51.