current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSKMLast
1 -62.0001eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  100  1LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSKM 136
2 -54.3001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  24  2LSAAEADLAGKSWAPVFANGDAFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDHSSTIFTRLNEFVNNAANMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPAGADAAWTKLFGLIIDALKAAG 145
3 -54.1001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  34  7MEAGDIALVKSSWAQIHDKEVDILYNFFKSYPASQAKFSAFAGKDLESLKDTAPFALHATRIVSVINEAIALMGVAENVLKQQGINHKGRGVTAAHFEEFETALEAFLESH--NAGTKKAWDSAFNNMYSVVFPEL 150
4 -54.1001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  24  3LSAAEADLAGKSWAPVFANGLDFLVALFEKFPDSANFFADFKGKSVADIKASPKLRDVSSRIFTRLNEFVNNAANMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPAGADAAWTKLFGLIIDALKAA. 145
5 -53.6002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  19  3LTQTQIDSILADLAHHTEMGVSIYKTLFAAHPEYISYFSKLQGLTKDNVGQSEGIRYYGRTLGEELIRLLKAASNLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAIAAKM 148
6 -53.4001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  19  13LTPAEKDLIRSTWDQLMTHVADVFIRIFHNDPTAQRKFPQMAGLSPAELRTSRQMHAHAIRVSALMTTYIDEMDTLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGTKQVHDAWAKTFAIVQGVLITKH 157
7 -53.0002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  16  1MNSEEVNDIKRTWEVVAAKGVEMLKRYFKKYPHNLNHFPWFKEIPFDDLPENARFKTHGTRILRQVDEGVKALSVFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKNEKQVHAYHKFFDRAYDIAFAEM 147
8 -52.9001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  18  2LTKHEQDILLKELGPHVETGLGAYHALFTAHPQYISHFSRLEGHTIENVMQSDGIKHYARTLTEAIVHMLKEISNVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEGKAAVEKFLKHVFPMMAAEI 147
9 -52.8001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  25  5LSDSEEKLVRDAWAPIHGDANTVFYNYLKKYPSNQDKFETLKGHPLDEVKDTANFKLIAGRIFTIFDNCVKNVGNFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH----DSTHGAAWNKMMDNFFYVFYECL 144
10 -52.5001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  20  13LTLAQKKIVRKTWHQLMRNVTDVFIRIFAYDPSAQNKFPQMAGMSASQLRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGNEKTRDAWAKAFSVVQAVLLVKH 157
11 -52.3001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  18  2LTAAQIKAIQDHWFLNQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSDPTTVAAWGDAAGVLVAAM.... 140
12 -51.5003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  14  4LTGPQKAALKSSWSRFMNNGTNFYMDLFKAYPDTLTPFKSFQNVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHEGSTKNAWEDFIAYICRVQGDFM 148
13 -51.0001myt_A mol:protein length:146 MYOGLOBIN  ali model follow..  17  1...ADFDAVLKCWGPVEADGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAISAHGATVLKKLGELLKAKGSHAAILKPLANSHATKKIPINNFKLISEVLVKVMHEKAGDAGGQTALRNVMGIIIADLEANY 139
14 -51.0004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  14  9VSEEQQSLIMEDVQVLLPNVEDVLQQFMEENPETFQIFPWADAKTAKEMRSHPRFKSHAKSIGKVISDCLVDLNGHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSSEEKKEAWLKAYGIITVMVTE.. 154
15 -51.0002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  24  1MNSDEVQLIKKTWEIPVATGAAILTQFFNRFPSNLEKFP-FRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTAASSDESQAATWAKLVDHVYAIIFKAI 146
16 -50.9001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  30  2LEAAQKSNVTSSWAKASAAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNLEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD---EGAWTAVAGALMGEIEPDM 142
17 -50.9001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  30  2LSAAQKDNVTSSWAKASAAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNLEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD---EGAWTAVAGALMGEIEPNM 142
18 -50.9001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  30  2LSAAQKDNVKSSWAKASAAGPEFFMALFDAHDDVFAKFSGFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNLEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD---EGAWTAVAGALMGMIRPDM 142
19 -50.7001myh_A mol:protein length:153 MYOGLOBIN  ali model follow..  20  2LSDGEWQLVLNVWGKVEADGQEVLIRLFKGHPETLEKFDRFKHLKSDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELTPLAQSHATHKIPVKYLEFISEAIIQVLQSKHPGADAQGAMSKALELFRNDMAAKY 146
20 -50.7002nrl_A mol:protein length:147 Myoglobin  ali model follow..  17  1..XADFDAVLKCWGPVEADGGLVLTRLFKEHPETQKLFPKFAGIAQADIAGNAAVSAHGATVLKKLGELLKAKGSHAAILKPLANSHATKKIPINNFKLISEVLVKVMQEKAGDAGGQTALRNVMGIIIADLEANY 140
21 -50.6005oja_A mol:protein length:163 Myoglobin  ali model follow..  22  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPEILEKFDDLKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
22 -50.6005oj9_A mol:protein length:163 Myoglobin  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKTAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
23 -50.5001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  17  3LSEDQEHYIKGVWKDVDHKTAKALERVFVVYPWTTRLFSKLQGLFSAN---DIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKRPKEHAAAYKFFRLVAEALSSNY 140
24 -50.5002ohb_A mol:protein length:154 Myoglobin  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKKIPIKYLEFWSEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
25 -50.5001co8_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYAEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
26 -50.5002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDIYIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
27 -50.4001lhs_A mol:protein length:153 MYOGLOBIN  ali model follow..  19  2LSDDEWNHVLGIWAKVEPDGQEVIIRLFQLHPETQERFAKFKNLTIDALKSSEEVKKHGTTVLTALGRILKQKNNHEQELKPLAESHAKHKIPVKYLEFICEIIVKVIAEKHPGADSQAAMKKALELFRNDMASKY 146
28 -50.4001ch5_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKVKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
29 -50.4002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  19  4LTNPQKAAIRSSWSKFMDNGQGFYMDLFKAHPETLTPFKSFGGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEDHNHVGGAKDAWEVFVGFICKTLGDYM 148
30 -50.4003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  16  9FTEEQEALVVKSWSVMKKNGLKLFIKIFEIAPTTKKMFSFLRDSP-IPAEQNPKLKPHAMSVFVMCCESAVQLRKRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPSPEMKVAWGQAYDHLVAAIKAEM 156
31 -50.3002oha_A mol:protein length:154 Myoglobin  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELWRKDIAAKY 147
32 -50.3001h97_A mol:protein length:147 GLOBIN-3  ali model follow..  18  2LTKHEQDILLKELGPHVETGLGAYHALFTAHPQYISHFSRLEGHTIENVMQSEGIKHYARTLTEAIVHMLKEISNVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAVEKFLKHVFPMMAAEI 147
33 -50.3001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVRVLTALGAILKKKGHHEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
34 -50.3005zeo_A mol:protein length:153 Myoglobin  ali model follow..  20  2LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRSKHLKEAEMKASEDLKKHGCTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 146
35 -50.2003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  18  10FTEEQEALVVKSWAVMKKNGLKFFLKIFEIAPSAKNLFSYLKDSP-IPLEQNPKLKPHAMTVFVMTCESAVQLRKRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPSPEMKNAWGEAYDQLVAAIKSEM 157
36 -50.2005ojc_A mol:protein length:163 Myoglobin  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDTLIRLFKSHPEILEKFDGLKHLKEAEMKASEDLKEHGVTLLTALGAILKKKGHHEAELKPLAQSHAAKKIPIKHLEFFSEAIIHVLHSRHPGADAQGAMNKALELFRTDIAAKY 147
37 -50.2004pqb_A mol:protein length:154 Myoglobin  ali model follow..  19  3LSEGEWQLVLHVWAKVEADGQDIEIRLFKSHPETLEKHDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
38 -50.2001cik_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKTAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATHKAPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
39 -50.2001mnh_A mol:protein length:153 MYOGLOBIN  ali model follow..  20  2LSDGEWQLVLNVWGKVEADGQEVLIRLFKGHPETLEKFDKFKHLKEDEMKASEDLKKVGNRVLTALGGILKKKGHHEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGADAQGAMSKALELFRNDMAAKY 146
40 -50.2006bmg_A mol:protein length:154 Myoglobin  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKHHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMSKALELFRKDIAAKY 147
41 -50.2005zzf_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKYDRFKHLKEAEMKASEDLKKDGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 146
42 -50.2004fwx_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSEGEWQLVLHVWAKVEADGQDIHIRLYKSHPETLEKHDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 146
43 -50.2005ych_A mol:protein length:154 Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)  ali model follow..  21  3LSDGEWQLVLNIWAKVEADGQDVLIRLFKGHPETLEKFDKFKHLKEAEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
44 -50.1001emy_A mol:protein length:153 MYOGLOBIN  ali model follow..  18  2LSDGEWELVLKTWGKVEADGETVFVRLFTGHPETLEKFDKFKHLKEGEMKASEDLKKQGVTVLTALGGILKKKGHHEAEIQPLAQSHATHKIPIKYLEFISDAIIHVLQSKHPGADAQGAMKKALELFRNDIAAKY 146
45 -50.1005eui_B mol:protein length:146 HBB protein  ali model follow..  19  3LSGEEKAAVTALWGKVNVDGGETLGRLLVVYPWTQRFFETFGDLSASAVMGNAKVKAHGKKVMNAFSEGLHHLDNLKGTFAKLSELHCKLHVDPENFKLLGNVLVVVLSHHLGTPQAQAAWQKVVSGVANALAHKY 145
46 -50.100101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRVKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
47 -50.1001mcy_A mol:protein length:154 MYOGLOBIN (CARBONMONOXY)  ali model follow..  19  3LSEGEWQLVLHVWAKVEADGQDIFIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKQGVTVLTALGAILKKKGHHEAELKPLAQSHATHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
48 -50.1001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  3LSEGEWQLVLHVWAKVEADGQDIFIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKQGVTFLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
49 -50.1001dxc_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDIYIRLFKSHPETLEKFDRFKHLKTAEMKASEDLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
50 -50.1001ch1_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPGAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
51 -50.1001do1_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDIWIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
52 -50.1004lpi_A mol:protein length:154 Myoglobin  ali model follow..  19  3LSEGEWQLVLHVWAKVEADGQDIHIRLFKSHPETLEKYDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
53 -50.1002qu0_B mol:protein length:145 Hemoglobin subunit beta  ali model follow..  15  2LTAEEKAAVTGFWGKVKVDGAEALGRLLVVYPWTQRFFEHFGDLSNADVMNNPKVKAHGKKVLDSFSNGMKHLDDLKGTFAQLSELHCKLHVDPENFRLLGNVLVVVLARHHGTPVLQADFQKVVAGVANALAHKY 144
54 -50.1005utb_A mol:protein length:154 Myoglobin  ali model follow..  21  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTALTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFYSEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
55 -50.1003rgk_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSDGEWQLVLNVWGKVEADGQEVLIRLFKGHPETLEKFDRFKHLKEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATHKIPVKYLEFISEAIIQVLQSKHPGADAQGAMNKALELFRKDMASNY 146
56 -50.1002oh8_A mol:protein length:154 Myoglobin  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDWLIRLFKSHPETLEKFDRFKHLKEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
57 -50.1005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  20  6LSDGEWQLVLNVWGKVEADGQEVLIRLFTGHPETLEKFDKFKHLKTDEMKASEDLKKHGNTVLTALGGILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQSKHPGADAQGAMNKALELFRNDIAAKY 150
58 -50.1002r4x_A mol:protein length:146 Globin-1  ali model follow..  12  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGVSITLMYALQNFIDQLDNLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
59 -50.0004twv_A mol:protein length:154 Myoglobin  ali model follow..  19  3LSDGEWQQVLNVWGKVEADGQEVLIRLFTGHPETLEKFDEFKHLKEAEMKASEDLKEHGTVVLTALGGILKKKGHHEAELKPLAQSHATEKIPIKYLEFISDAIIHVLHSKHPGADAQGAMTKALELFRNDIAAKY 147
60 -50.0003wyo_B mol:protein length:153 Myoglobin  ali model follow..  20  2LSDGEWQQVLNVWGKVEADGQEVLIRLFTGHPETLEKFDKFKHLKTAEMKASEDLKKHGTVVLTALGGILKEDGHHEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLHSKHPGADAQGAMTKALELFRNDIAAKY 146
61 -50.0003wyo_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSDGEWQQVLNVWGKVEADGQEVLIRLFTGHPETLEKFDKFKHLKEAEMKASEDLKKVGTVHLTALGGILKKKGHHEAKLKPLAQSHAKHKIPIKYLEFISDAIIHVLHSKHPGADAQGAMTKALELFRNKIAAKY 146
62 -50.0002e2y_A mol:protein length:154 Myoglobin  ali model follow..  20  3LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKWDRFKHLKEAEMKASEDLKKDGVTILTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 147
63 -50.0001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  16  3LTESQAALVKSSWEEFNANTHRFFILVLEIAPAAKDLFSFLKGTS-EVPQNNPELQAHAGKVFKLVYEAAIQLEVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGSEELNSAWTIAYDELAIVIKKEM 149
64 -50.0001m6c_A mol:protein length:153 PROTEIN (MYOGLOBIN)  ali model follow..  20  2LSDGEWQLVLNVWGKVEADGQEVLIRLFKGHPETLEKFDKFKHLKEDEMKASEDLKKHGNTNLTALGGILKKKGHHEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGADAQGAMSKALELFRNDMAAKY 146
65 -50.0003uh6_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSIALMYALQNFIDQLDNLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
66 -50.0001mbs_A mol:protein length:153 MYOGLOBIN  ali model follow..  21  2LSDGEWHLVLNVWGKVETDGQEVLIRLFKSHPETLEKFDKFKHLKEDDMRRSEDLRKHGNTVLTALGGILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSKHPGADAQAAMKKALELFRNDIAAKY 146
67 -50.0004ns2_A mol:protein length:154 Myoglobin  ali model follow..  19  3LSDGEWQQVLNVWGKVEADGQEVLIRLFTGHPETLEKFKKFKHLKTAEMKASEKLKKHGTVVLTALGGILKKKGHHEAKLKPLAQSHATKKIPIKYLEFISDAIIHVLHSKHPGADAQGAMTKALELFRNDIAAKY 147
68 -49.9005hlq_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSEGEWQLVLHVWAKVEADGQDILIRLFKSHPETLEKHDRFKHLKTAEMKASEDLKKAGVTVLTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 146
69 -49.9003uhc_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQAFIDQLDNLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
70 -49.9003uhd_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
71 -49.9003ugz_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVAAMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
72 -49.9003ugy_A mol:protein length:146 Globin-1  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNYIDQLDNLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
73 -49.9001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  13  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGNV--SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
74 -49.9003k9z_A mol:protein length:153 Myoglobin  ali model follow..  19  2LSEGEWQLVLHVWAKVEADGQDIHIRLFKSHPETLEKHDRFKHLKEAEMKASEDLKKHGVTELTALGAILKKKGHHEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGADAQGAMNKALELFRKDIAAKY 146
75 -49.9003uhb_A mol:protein length:146 Globin-1  ali model follow..  12  10LTADVKKDLRDSWKVIGSDGVALMTTLFADNQETIGYFKRLGDV--SQGMANDKLRGHSITLMYALQNFIDQLDNLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.