current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAYLast
1 -69.8001it2_A mol:protein length:146 hemoglobin  ali model follow..  100  1PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAY 146
2 -61.5001f5o_A mol:protein length:149 HEMOGLOBIN V  ali model follow..  41  1PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAGDAGFEKLMSMICILLRSAY 149
3 -61.5002lhb_A mol:protein length:149 HEMOGLOBIN V (CYANO MET)  ali model follow..  40  1PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGTADELKKSADVRWHAERIINAVDDAVASMDDTEKMSMKLRNLSGKHAKSFQVDPEYFKVLAAVIADTVAGDAGFEKLMSMICILLRSAY 149
4 -61.2001uc3_A mol:protein length:149 Globin  ali model follow..  41  1PIVDSGSVAPLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGSADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKSFQVDPQYFKVLAAVIADTVAGDAGFEKLMSMICILLRSAY 149
5 -55.4004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  14  1..MATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADATAKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHT-KKKVPTELFGKLGGCILTQVVKRVSEAKWSEEKKEAWLKAY 145
6 -54.3002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  19  1.MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSDVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHL-KYGVADGHFEVTRFALLETIKEALPADMWGPEMRNAWGEAY 147
7 -54.2001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  17  7...NNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHL-KYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAY 151
8 -53.6002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  17  6...ADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHL-RYGVADGHFEVTGFALLETIKEALPADMWSLEMKKAWAEAY 150
9 -53.5001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  22  12...RRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHDPLEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAWAKLRGLIYSHVTAAY 166
10 -52.9001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  23  1........XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKSADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAAWTKLFGLIIDALKAAG 146
11 -52.5003uh6_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
12 -52.5003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  17  1..MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKRETTLKRLGASHS-KYGVVDEHFEVAKYALLETIKEAVP-EMWSPEMKVAWGQAY 145
13 -52.4003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  19  1.MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKRESNLKRLGAIHF-KNGVVNEHFEVTRFALLETIKEAVP-EMWSPEMKNAWGEAY 146
14 -52.4002r4x_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKMNGPIKKVLKYANAWAKLVAVVQAAL.... 146
15 -52.4001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  16  1......AFVGLSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETLKGPLDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHV-ARPITHGSYNDLRGVIYDSMTHGAAWNKMMDNFFYVFYECL 144
16 -52.4001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
17 -52.4003uhi_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
18 -52.4003uhb_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TKKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
19 -52.3003ugy_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
20 -52.3002auo_A mol:protein length:146 Globin I  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
21 -52.3003uhd_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
22 -52.3003ugz_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
23 -52.3003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  18  1.MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKKESDLKRIGAIHF-KTGVVNEHFEVTRFALLETIKEAVP-EMWSPEMKNAWGVAY 146
24 -52.3003uhc_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
25 -52.3002r4z_A mol:protein length:146 Globin-1  ali model follow..  11  1PSV-YDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
26 -52.2001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  22  1.........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKSADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHV-GFGVGSAQFENVRSMFPGFVASVAAWTKLFGLIIDALKAAG 145
27 -52.2002grf_A mol:protein length:146 Globin-1  ali model follow..  12  1PSV-YDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDV-SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHI-TRKISAAEFGKINGPIKKVLKYANAWAKLVAVVQAAL.... 146
28 -52.2004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  1XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDV-QKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHI-NRKISGDAFGAIVEPMKETLKARMG-NYYSDDVAGAWAALV 143
29 -52.0003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  15  1.......SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLNVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHF-NRGIRIKELRDGYGVLLRYLEDHCAWEDFIAYICRVQGDFM 148
30 -51.9002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  17  1.......XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHN-NRGIRASDLRTAYDILIHYMGAKDAWEVFVGFICKTLGDYM 148
31 -51.9004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  11  4.VAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDV-SAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHI-NRQISADEFGEIVGPLRQTLKARMG-NYFDEDTVAAWASLV 145
32 -51.7001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  22  15...RRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFAWAKLRGLIYSHVTAAY 169
33 -51.4005oja_A mol:protein length:163 Myoglobin  ali model follow..  16  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFFSEAIIHVLHSRHAMNKALELFRKDIAAKY 147
34 -51.3002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  16  1..........MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHI-PRTVSKESYNQLKGVILDVLSQAATWAKLVDHVYAIIFKAI 146
35 -51.2005yci_A mol:protein length:157 Ancestral myoglobin aMbWb` of Basilosaurus relative (polyphyly)  ali model follow..  18  1.....GSHMGLSDGEWQLVLNIWGKVEADVAGHGQDVLIRLFKGHPETLEKFDKFKHTEAEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHAMNKALELFRKDIAAKY 150
36 -51.2002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFFSEAIIHVLHSRHAMNKALELFRKDIAAKY 147
37 -51.2005oj9_A mol:protein length:163 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
38 -51.1001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVRVLTALGAILKKKGH---HEAELKPLAQDHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
39 -51.1005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  17  1.....GSHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHTEDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLQSKHAMNKALELFRNDIAAKY 150
40 -51.0001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  12  1.........SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHK-ARGISAGQLEAAFKVLSGFMKSYGAWTAVAGALMGEIEPD. 141
41 -51.0001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVTFLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
42 -51.0002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  10  1.......GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHR-AVGVRLSSFSTVGESLLYMLEKSLAWSRLYGAVVQAMSRGW 151
43 -51.0004pqb_A mol:protein length:154 Myoglobin  ali model follow..  15  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIEIRLFKSHPETLEKHDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
44 -51.0002oha_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELWRKDIAAKY 147
45 -50.9005utb_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTALTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFYSEAIIHVLHSRHAMNKALELFRKDIAAKY 147
46 -50.9001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  12  1.........SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHK-ARGISAGQLEAAFKVLSGFMKSYGAWTAVAGALMGEIEPN. 141
47 -50.9001cik_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKAPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
48 -50.9001dxc_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
49 -50.9001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  17  2.........ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHV-SKGVADAHFPVVKEAILKTIKEVVG-AKWSEELNSAWTIAY 138
50 -50.9006bmg_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHSEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMSKALELFRKDIAAKY 147
51 -50.900101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
52 -50.9001mcy_A mol:protein length:154 MYOGLOBIN (CARBONMONOXY)  ali model follow..  18  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
53 -50.8004lpi_A mol:protein length:154 Myoglobin  ali model follow..  16  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
54 -50.8001ch5_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKVKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
55 -50.8001do1_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
56 -50.8001co8_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYAEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
57 -50.8001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  13  1.........SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHK-ARGISAGQLEAAFKVLAGFMKSYGAWTAVAGALMGMIRPD. 141
58 -50.8001ch1_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  16  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPGAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
59 -50.8005ojc_A mol:protein length:163 Myoglobin  ali model follow..  15  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHLKAEMKASEDLKEHGVTLLTALGAILKKKGH---HEAELKPLAQSHAAKHKIPIKHLEFFSEAIIHVLHSRHAMNKALELFRTDIAAKY 147
60 -50.7002e2y_A mol:protein length:154 Myoglobin  ali model follow..  18  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKWDRFKHLKAEMKASEDLKKDGVTILTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
61 -50.7004u8u_A mol:protein length:150 Globin a chain  ali model follow..  15  1......DDDCCSAEDRREIQHIWDTVTDRKVAIAGAVFKDLFHHYPSAKGLFERVK---VAEPDSGEYHSHLVRVANGLDLLINLFQDTQVLDKQLAHLAEQHILRKGVTQQFFKGIGESFARVFPQVSAWNRCFHTLADRISRDL 148
62 -50.7002ohb_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFWSEAIIHVLHSRHAMNKALELFRKDIAAKY 147
63 -50.7001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  16  1....DEHEHCCSEEDHRIVQKQWDILWRDTEGFGRLLLTKLAKDIPEVNDLFKRVD---IEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLAWKSCLKGILTKISSRL 151
64 -50.6005ych_A mol:protein length:154 Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)  ali model follow..  18  1........MVLSDGEWQLVLNIWAKVEADVAGHGQDVLIRLFKGHPETLEKFDKFKHTEAEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSRHAMNKALELFRKDIAAKY 147
65 -50.6004u8u_C mol:protein length:151 Globin c Chain  ali model follow..  19  1......HQFCCSAEDRNIVQKQWSVLWGDTESFGRLILTKLAKEIPEVKELFNKVD---IDNPEGGPFSAHCLRILNALDMSINLMDDPEALDSALDHLADQHHDRPGVKKAHFKKIAEILHTGLQQVLSWKSCFKGILGKIASKL 149
66 -50.6001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  14  1.......AANCADAAAAIVQAQWEDVAASRVSAGEEVFAALFKMVPAAKNLFTRVN---VADINSPEFQGHVVRVMGGLDILINALDDIPTLESMLDHLAGQHAVRDGVTGAGFQLMATVLMESLPQVVAWASCLAGIAAAISSAL 148
67 -50.6001fcs_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKVGVRVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
68 -50.600106m_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTFLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
69 -50.6001ofk_A mol:protein length:154 MYOGLOBIN  ali model follow..  16  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKHDRFKHTEAEMKASEDLKKLGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
70 -50.500102m_A mol:protein length:154 MYOGLOBIN  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKAGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
71 -50.5004ns2_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MGLSDGEWQQVLNVWGKVEADIAGHGQEVLIRLFTGHPETLEKFKKFKHTEAEMKASEKLKKHGTVVLTALGGILKKKGH---HEAKLKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKHAMTKALELFRNDIAAKY 147
72 -50.5001myh_A mol:protein length:153 MYOGLOBIN  ali model follow..  16  1.........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHSEDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELTPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHAMSKALELFRNDMAAKY 146
73 -50.5002oh8_A mol:protein length:154 Myoglobin  ali model follow..  16  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDWLIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
74 -50.5001lue_A mol:protein length:154 Myoglobin  ali model follow..  17  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHTEAEMKASEDLKKDGVTALTALGAILKKKGH---HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHAMNKALELFRKDIAAKY 147
75 -50.4001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  10  1..........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHR-AVGVKLSSFSTVGESLLYMLEKSLAWSQLYGAVVQAMSRGW 148

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.