current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIKLast
1 -65.6001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  100  1ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIK 140
2 -64.7004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  57  1DCSILELLKVKNQWREAFGEGHHRVQFGLELWKRFFDTHPEVKGLFKGVNGDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGIK 140
3 -64.1003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  42  1DCNILQRLKVKMQWAKAYGFGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGIT 140
4 -63.1004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  47  2ECDVLTRLKVKAQWRRAYSHGHNREDFAQAIWRALFAQVPDSRTLFKRVHGHDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGIK 141
5 -62.6001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  46  3QCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIK 142
6 -62.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  39  2ECGPLQRLKVKRQWAEAYGSGNGREEFGHFIWANVFKVAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKAWQACLDVITSGIQ 142
7 -62.0001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  42  2.CAMLERAKVKDEWAKAYGIGAARSKFGDALWRNVFNYAPNARDIFESVNSKDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVPAWQGCYNIIAKGIT 140
8 -61.9002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  36  1DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDDAWNSCMNQIVSGIS 141
9 -61.8001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  37  3VCGPLQRLKVKRQWAEAYGSGNSREEFGHFIWSHVFQHSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQAWKPCLNVITNGIQ 143
10 -59.3002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  34  2.CNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCF-NQHAWGECYERIASGIS 139
11 -56.1002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  13  3.LTQTQIDSILADLAHHTDTTEHITEMGVSIYKTLFAAHPEYISYFSKLQDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAIA 145
12 -55.4001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  10  1TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEGKAAVEKFLKHVFPMM. 143
13 -55.2004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  19  13.SNADQKDLLRMSWGVL---SVDMEGTGLMLMANLFKTSPSAKGKFARLGDAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDAWASLVAVVQAAL. 152
14 -55.1001yhu_D mol:protein length:149 hemoglobin B2 chain  ali model follow..  29  3SCTTEDRREMQLMWGNVWQFTGRRIAIAQAVFKDLFANVPDAVGLFGAVKGDEVNSNEFKAHCIRVVNGLDSSIGLLSDPATLNEQLSHLATQHKARGVTKGGFSAIAQSFLRVMPQ-VASCFNPDAWSRCFNRITTGMT 144
15 -54.8003wct_C mol:protein length:150 B2 globin chain of giant V2 hemoglobin  ali model follow..  31  4SCTTEDRREMQLMWANVWSFTGRRLAIAQAVFKDLFAHVPDAVGLFDRVHGTEIDSSEFKAHCIRVVNGLDSAIGLLSDPSTLNEQLSHLATQHQERGVTKGGFSAIAQSFLRVMPQ-VASCFNPDAWSRCFNRITNGMT 145
16 -54.6004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  18  11.GSEAIKANLRRSWGVL---SADIEATGLMLMSNLFTLRPDTKTYFTRLGQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDAWAALVGVVQAAL. 150
17 -54.5002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  20  3HMERPESELIRQSWRVV---SRSPLEHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPAAWSRLYGAVVQAM. 147
18 -54.5004u8u_A mol:protein length:150 Globin a chain  ali model follow..  25  4CCSAEDRREIQHIWDTVWSFTDRKVAIAGAVFKDLFHHYPSAKGLFERVKVAEPDSGEYHSHLVRVANGLDLLINLFQDTQVLDKQLAHLAEQHIRKGVTQQFFKGIGESFARVFPQVSSC-FNLEAWNRCFHTLADRIS 145
19 -54.4001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  20  1.MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPAAWSQLYGAVVQAMS 145
20 -54.2004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  20  1.MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPAAWSQLYGAVVQAMS 145
21 -53.9004u8u_C mol:protein length:151 Globin c Chain  ali model follow..  29  5.CSAEDRNIVQKQWSVLWGDTESSIAFGRLILTKLAKEIPEVKELFNKVDIDNPEGGPFSAHCLRILNALDMSINLMDDPEALDSALDHLADQHHDRGVKKAHFKKIAEILHTGLQQVLDDYNA-LSWKSCFKGILGKIA 146
22 -53.5002d2m_C mol:protein length:147 Giant hemoglobin, B2(c) globin chain  ali model follow..  30  4.CSSEDRANVMHNWDAAWSYSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARGVAAAHFDVMAEAFAEVMPQ-VSSCFSSDSWNRCFARIANGIS 144
23 -53.4003wct_D mol:protein length:149 B1 globin chain of giant V2 hemoglobin  ali model follow..  34  4.CSEADATIVIKQWNQIYNGAKSRWTMGNEIFSSLFKLKPESEVLFNNVNVANMSSGAFHAHTVRVLSGLDMGINYLNDAGTLTSLTAHLAAQHVARGLKAVYFDAMGKVLMTVLPS-LIDNFNPDAWRNCLLPLKNAIA 145
24 -53.4001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  31  3NCADAAAAIVQAQWEDVWSAAASRVSAGEEVFAALFKMVPAAKNLFTRVNVADINSPEFQGHVVRVMGGLDILINALDDIPTLESMLDHLAGQHAVRGVTGAGFQLMATVLMESLPQVVEGF-NPDAWASCLAGIAAAIS 145
25 -53.2004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  12  8QVSEEQQSLIMEDVQVL---LPNYDDFVEDVLQQFMEENPETFQIFPWADKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEA-KKEAWLKAYGIITVMVT 153
26 -53.2001h97_A mol:protein length:147 GLOBIN-3  ali model follow..  10  1TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAFLKHVFPMMAAEI. 147
27 -53.1003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  18  10.FTEEQEALVVKAWAVM---KKNSAELGLQFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHATTVFVMTCESAVQLRKAGVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEAWGVAYDQLVAAIK 154
28 -52.8001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  2.LSAAQRQVIAATWKDIAG-ADNGAGVGKKCLIKFLSAHPQMAAVFGFSGA---SDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAAAWAAAYADISGAL. 141
29 -52.7001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  17  1SLSAAEADLAGKSWAPV---FANKNANGDAFLVALFEKFPDSANFFADFKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGDAAWTKLFGLIIDALK 142
30 -52.7001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  18  3.LTESQAALVKSSWEEF---NANIPKHTHRFFILVLEIAPAAKDLFSFLKEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEEAWTIAYDELAIVI. 145
31 -52.6001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  17  2SLSAAEADLAGKSWAPV---FANKNANGLDFLVALFEKFPDSANFFADFKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPAGADAAWTKLFGLIIDALK 143
32 -52.6001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  31  7.CSEEDHRIVQKQWDILWRSSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVEGVQKAHFKKFGEILATGLPQVLDDY-DALAWKSCLKGILTKIS 148
33 -52.5003uhc_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
34 -52.5003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  19  10.FTEEQEALVVKSWAVM---KKNSAELGLKFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEAWGEAYDQLVAAIK 154
35 -52.4003uhb_A mol:protein length:146 Globin-1  ali model follow..  17  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
36 -52.4003uh6_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
37 -52.4003uhi_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
38 -52.4001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
39 -52.4002grf_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALVTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
40 -52.4001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  21  12DLTLAQKKIVRKTWHQL---MRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKAWAKAFSVVQAVL. 153
41 -52.4002r4x_A mol:protein length:146 Globin-1  ali model follow..  17  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
42 -52.4003uhd_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
43 -52.4003ugz_A mol:protein length:146 Globin-1  ali model follow..  17  9QLTADVKKDLRDSWKVI---GSDKKGNGVAAMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
44 -52.3003ugy_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
45 -52.3002auo_A mol:protein length:146 Globin I  ali model follow..  18  9QLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
46 -52.3001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  21  2.LSAAQRQVVASTWKDIAG-ADNGAGVGKECLSKFISAHPEMAAVFGFSGA---SDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAWAAAYGDISGAL. 141
47 -52.3001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  18  2.LSAAQRQVVASTWKDIAG-SDNGAGVGKECFTKFLSAHHDMAAVFGFSGA---SDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAWAAAYADISGAL. 141
48 -52.3001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  21  12DLTPAEKDLIRSTWDQL---MTHRTGFVADVFIRIFHNDPTAQRKFPQMAGELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQAWAKTFAIVQGVL. 153
49 -52.3002r4z_A mol:protein length:146 Globin-1  ali model follow..  18  9QLTADVKKDLRDSWKVW---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL. 146
50 -52.2001x9f_A mol:protein length:151 Globin IV, extracellular  ali model follow..  28  7.CSYEDRREIRHIWDDVWSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRGVTKEYFRGIGEAFARVLPQVLSCF-NVDAWNRCFHRLVARIA 147
51 -52.1003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  19  9.FTEEQEALVVKSWSVM---KKNSAELGLKLFIKIFEIAPTTKKMFSFLRDPAEQNPKLKPHAMSVFVMCCESAVQLRKTGVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEAWGQAYDHLVAAIK 153
52 -52.0002zfo_D mol:protein length:145 Extracellular giant hemoglobin major globin subunit B1  ali model follow..  22  2CCSRGDAEVVISEWDQVFNAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGD--SSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAIGVTGAAVTHLSEAISSVVAQVLPSAHI-DAWGYCMAYIAAGIG 142
53 -52.0001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  20  1SLEAAQKSNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGDE---GAWTAVAGALMGEIE 139
54 -51.8001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  20  1SLSAAQKDNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGDE---GAWTAVAGALMGEIE 139
55 -51.8001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  14  3.FTEKQDALVSSSFEAF---KANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDEAWEVAYDELAAAI. 140
56 -51.8001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  21  1SLSAAQKDNVKSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDE---GAWTAVAGALMGMIR 139
57 -51.5003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  18  4.LTGPQKAALKSSWSRF---MNNAVTNGTNFYMDLFKAYPDTLTPFKSLFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHEGSTKNAWEDFIAYICRVQG 145
58 -51.4002d2m_D mol:protein length:145 Giant hemoglobin, B1(d) globin chain  ali model follow..  22  2CCSRGDAEVVISEWDQVFNAGSSESAVGVAIFDAFFASSGVSPSMFPGGGD--SNNPEFLAQVSRVVSGADIAINSLTNRATCDSLLSHLNAQHRAIGVTGAAVTHLSQAISSVVAQVLPSAHI-DAWEYCMAYIAAGIG 142
59 -50.7001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  16  13SFSEEQEALVLKSWAIL---KKDSANIALRFFLKIFEVAPSASQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVADMWSPAAWSEAYDHLVAAI. 158
60 -50.5002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  18  10.FSEEKEALVLKSWAIM---KKDSANLGLRFFLKIFEIAPSARQMFPFLRVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALADMWGPEAWGEAYDQLVAAIK 155
61 -50.4002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  18  13.FGEEQEALVLKSWAVM---KKDAANLGLRFFLKVFEIAPSAKQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKEALADMWSLEAWAEAYSQLVAAIK 158
62 -50.3001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  22  18ELSEAERKAVQAMWARL---YANSEDVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPEAWAKLRGLIYSHVT 163
63 -50.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  20  4.LTNPQKAAIRSSWSKF---MDNGVSNGQGFYMDLFKAHPETLTPFKSLLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMED--HNHMVGGAWEVFVGFICKTLG 145
64 -50.2001la6_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  17  2SLSDKDKAAVRALWSKI---GKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPSNFKILNHCILVVISTMFPKEFTPESLDKFLSGVALALA 139
65 -50.0001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  13  2.LDQQTINIIKATVPVL---KEHGVTITTTFYKNLFAKHPEVRPLFDM------GRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDAWGKAYGVIADVF. 133
66 -50.0001hbh_A mol:protein length:143 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  17  2SLSDKDKAAVRALWSKI---GKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPANFKILNHCILVVISTMFPKEFTPESLDKFLSGVALALA 139
67 -50.0005jgg_A mol:protein length:142 Alpha chain  ali model follow..  17  1TLTSADKSHVKSIWSKA---SGKAEELGAEALGRMLEVFPNTKTYFSHYADLSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLH--AKTLRVDPANFKILSHTILVVLALYFPADFTPEACDKFLASVSHTL. 137
68 -49.7005jnz_A mol:protein length:142 Alpha chain  ali model follow..  16  2.LTSADKSHVRSIWSKA---GGSAEEIGAEALGRMLESFPNTKTYFNHYADLSSSSAQVHTHGKKIIDALTTAVNHIDDITGALSSLSTLH--AQTLRVDPANFKILSHTILVVLALYFPADFTPEACDKFLANVSHAL. 137
69 -49.7003bcq_A mol:protein length:142 Alpha-chain hemoglobin  ali model follow..  16  2.LSDKDKDSIKAFWAKI---SPKAEDIGADALARMLTVYPQTKTYFSHWKDLSPGSAPVKKHGKTVMGSVAEAVSKIDDLTNGLLTLSELHAFQ--LRVDPANFKILSHNLLVVLAQQFPNDFTPESMDKFLSLLSWSLS 138
70 -49.7003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  17  2.IDQKEKELIKESWKRI---EPNKNEIGLLFYANLFKEEPTVSVLF---------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAWTKVYGIAAQVM. 130
71 -49.7001xq5_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  15  3.LSSKDKDTVKALWGKI---ADKAEEIGSDALSRMLAVYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGGIVDAVASIDDLNAGLLALSELHAFT--LRVDPANFKILSHCILVLLAVKFPKDFTPESYDKFFSALARALA 139
72 -49.6002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  16  1.MNSEEVNDIKRTWEVV---AAKMTEAGVEMLKRYFKKYPHNLNHFPWFKDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKNEKQVHAYHKFFDRAYDIA. 143
73 -49.6001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  11  4GLSDSEEKLVRDAWAPI---HGDLQGTANTVFYNYLKKYPSNQDKFETLKDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH----DSTHGAAWNKMMDNFFYVF. 140
74 -49.4004esa_A mol:protein length:143 Hemoglobin alpha chain  ali model follow..  18  3.LSDKDKAAVKLLWSKI---SKSSDAIGNDALSRMIVVYPQTKTYFAHWPDLSPGSPHVKAHGKTVMGGIALAVSKIDDLRAGLLDL--SEQHAYKLRVDPANFKILSHCILVVISMMFPKEFTPESLDKFLSGVSLALS 139
75 -49.4001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  15  2.LTAAQIKAIQDHWFLN--IKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSGLRSNPAYKAQTLTVINYLDKVVDALGGN--AGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSDPTTVAAWGDAAGVLVAAMK 141

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 8 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhao Y, Hong DH, Pawlyk B, Yue G, Adamian M, Grynberg M, Godzik A., Li T. The retinitis pigmentosa GTPase regulator (RPGR)- interacting protein: subserving RPGR function and participating in disk morphogenesis. Proc Natl Acad Sci U S A. 2003 Apr 1;100(7):3965-70. Epub 2003 Mar 21.