current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d2dc3a_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst EELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSLast
1 -37.100PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  17  1......QLALFKSSWNTVKHN----EVDILYAVFKANPDIQAKFPQFAGKDL-DSIKDSADFAVHSGRIVGFFSEVIGLIGNPENLKTLIDGLASSHK-ARGIEKAQFEEFRASLV........................................................ 107
2 -13.300PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  13  13.DFSSTDIDHLVAGAKYIKVLIPAVTNIVYRKLLQ-YDITARAFETRSTSFEGPLDAVPAEDSPQILHRKMFLRAYLARLCS-MTFWEYLDKVGMMHVGPLHVEYIHIGATLSLIQDVLTEAVLSHPRLSMGRALGKVIWIQNDLFAKWYVRDGEE................ 180
3 -7.490PF00502.19; APCD_SYNP2/6-160; Phycobilisome protein  ali follow..  11RYPSSGELSGIKRIAEALADNEKKIVDQAQKQLFSIHPEYRTSGGNAATTKQYNQCLRDYGW------YLRLVTYGI--AGDKDPIERIGLIGVKEMYNALGVPVPGMVDAIRCLKDAALGVLDSEEARIAAPYFDFITQAM.............................. 155
4 -7.100PF11075.8; Q089B5_SHEFN/10-184; Protein of unknown function VcgC/VcgE (DUF2780 topsan)  ali follow..  58SQLGLSQTQAEGGLGSLLSLAQTNLGENDFSQLSDSIPNADGLLAAVPALSSDSG----------MSGLLSQAGNLGSALQGSAMVYDAFEKLG--------ISKEYITPMVDIAKNYLQQSGGDGTVDLLMKG...................................... 173
5 -7.090PF11266.8; Q8DJB4_THEEB/11-228; Long-chain fatty aldehyde decarbonylase  ali follow..  1DYHSDRYKDAYSRINAIVI-EGEQEAHDNYIDLAKLLPQHQEELMEARHKKGFEACGRNLSVTPDMEFAKAFFEKLRANFQRALAEGKTATCLLIQALIIESFAIAAYNIYIPMADPFARKITESVVKDEYSHL...................................... 138
6 -7.020PF08897.11; D5WYH9_THIK1/5-137; Domain of unknown function (DUF1841 topsan)  ali follow..  12  2...KDEVRQFFLSAWQRHRAGGVLTPLEIAADWMELHPEYHAELTDPQSANRDYAVEQGRTNPFLHLSMHLTIAEQVSI-DQPPGIRQAFELLRSKRG-----EHEAHHAIMECLGEMLWTAQRSGLPPD-GAAYVDCVQ................................ 132
7 -6.560PF08064.13; ATR_CANGA/887-989; UME (NUC010) domain  ali follow..  2.............................................................LQDNILGIFQVFSSDMHDVEGKTTYYEKLRVINGISFLVKHASNKCIISALAQLSICLQSGLEPEVRYLSMRCWFLLIQRL.............................. 83
8 -6.190PF17544.2; H8K302_RICAG/57-431; Family of unknown function (DUF5460 topsan)  ali follow..  11  206.....KGRNIKNENLDLEMQNKELAFVELLHKNFKNNAVILDEVIKINNLHDIIKLAKSIKEYEFSILPLTNLNNEIVKLNSPSAIAINFDSLSGLHEICKSLGGDDSFKTISNFARLITIIRTANPKSEE---YKESITEIFEIFNPRYTDIDYQNCEMPLLADVSSLYDS 370
9 -6.170PF06021.11; F7BVP0_HORSE/2-206; Aralkyl acyl-CoA:amino acid N-acyltransferase  ali follow..  19  170SSLDVTHAALVNKFWH----GGNERSQRFIERCIRNFPN..................................................................................................................................... 205
10 -5.930PF08939.10; A0A0D2XVW8_FUSO4/23-278; Domain of unknown function (DUF1917 topsan)  ali follow..  11  139RDIRKEIKKASDDILHLAHAAKVRAGKWM---LFCTPAEVNDVWEIVAKATAKNELGIAAKVAPRPAD--RLICVYTTDFADKADVGRVLQKLRELRLVEARGRPIYYK............................................................... 248

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 8 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Jaroszewski L, Rychlewski L, Li Z, Li W, Godzik A. FFAS03: a server for profile--profile sequence alignments. Nucleic Acids Res. 2005 Jul 1;33(Web Server issue):W284-8.