current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}, from SCOP207

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKSDQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKFFVALVEYMRASGQSFDSQSWDRFGKNLVSALSSAGMKLast
1 -40.100PF00042.22; GLB8_CHITH/9-115; Globin  ali follow..  23  5.FKSSWNTVKHN----EVDILYAVFKANPDIQAKFPQFAGKDLDSIKDSADFAVHSGRIVGFFSEVIGLIGNPEALKTLIDGLASSHKARGIEKAQFEEFRASLV................................ 107
2 -10.400PF11563.8; F0XJU9_GROCL/20-199; Protoglobin  ali follow..  22.LVAGAKYIKVLIPAVTNIVYRKLLQ-YDITARAFTSFEGPLDAVPAEDSPQILHRKMFLRAYLARLCSDPSQMTFWEYLDKVGMMHVGLGRAHPLHSLIQDVLTEAVLSHPRLSMGRALGKVIWIQNDLFAKWYVR 176
3 -7.660PF08897.11; D5WYH9_THIK1/5-137; Domain of unknown function (DUF1841 topsan)  ali follow..  9.FLSAWQRHRAGGVLTPLEIAADWMELHPEYHAELTDPQSANRDYAVEQGRTNPFLHLSMHLTIAEQVSIDQPPGIRQAFELLRSKRGEHEAHHAIMECLGEMLWTAQRS--LPPDGAAYVDCVQ............ 132
4 -7.410PF00502.19; APCD_SYNP2/6-160; Phycobilisome protein  ali follow..  33...RIAEALADNEKKIVDQAQKQLFSIHPEYRT-----SGGNAATTKQYNQCLRDYGWYLRLVTYGILAGDKDPIERIGLIGVKEMYNALGVPVPGMVDAIRCLKDAALGVLDSEEARIAAPYFDFITQAM...... 155
5 -6.640PF01152.21; Q7CX73_AGRFC/7-127; Bacterial-like globin  ali follow..  7GGDATVRALTRR--------FYELMDTLPEAARCRA----------IHPADLSGSEAKFYDYLTGYLGGPPVYVE-----PMLRRRHFVAPIGPAERDEWLLCFRRAMDETENAKLREIIWAPVERLAFHMQN.... 121
6 -6.370PF15091.6; E9PKM2_HUMAN/1-454; Domain of unknown function (DUF4554 topsan)  ali follow..  190.VESSEEDQSQTMDPQGQTLLLFLFVDFHS------AFPVQQMEIWGVYTLLTTHLNAILVESHSVVQ-----GSIQFTVDKVLEQHHQAAKAQQKLQASLSVAVNSIMSILTGSTRSSFRK............... 299
7 -6.340PF16489.5; F1QBS8_DANRE/2108-2359; GPCR-Autoproteolysis INducing (GAIN) domain  ali follow..  10  1......................................................RSRSLASLLQSATGHVRTAYHLLASVLEHESLQQGFELTATHDTDFNRNIIKAGSAILDPLNQEHWEKIQRS-TANLLHQFEE 93
8 -6.340PF11075.8; Q089B5_SHEFN/10-184; Protein of unknown function VcgC/VcgE (DUF2780 topsan)  ali follow..  61GLSQT-SLLSLAQTNLGENDFSQLSDSIPNADGLLAAVPALSSDSGMSG---------LLSQAGNLGSALQGSAMVYDAFEKLG-------ISKEYITPMVDIAKNYLQQSGGDGTVDLLMKGLG............ 175
9 -6.170PF16043.5; H3BA08_LATCH/112-317; Domain of unknown function (DUF4795 topsan)  ali follow..  1.............QCQDAELLNHVQNAILLLQAECEKLNSTAGDLIEDHNKKQDDIDHLYETVEKLEEKKADKEIVDMEIDKADKFALANKVSRTQFDSTTEQLGKMIQDLLSKVQEQDWQKVIEKISTEMECKLDR 127
10 -5.950PF13749.6; D4JAQ7_9FIRM/299-384; Putative ATP-dependent DNA helicase recG C-terminal  ali follow..  1................GTDIQIKMFDDRIVVESPGRLPGLVKAGNIRHTHFSRN------PKIAEFLRDYNFVKEYGEGVDRMCRELEAAGLQSPEYRVNAFMLQATI............................. 86

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.