current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190
# Score Template Links and tools%idFirst AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILKLast
1 -70.900d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors  100  1AKKVKVITDPEVIKVMLEDTRRKILKLLRNKEMTISQLSEILGKTPQTIYHHIEKLKEAGLVEVKRTEMKGNLVEKYYGRTADVFYINLYLGDEELRYIARSRLKTKIDIFKRLGYQFEENELLNIMDRMSQKEFDATVRISKYIEEKEDALKDFSNEDIIHAIEWLSTAELARDEEYLELLKRLGSILK 190
2 -33.900d1xnpa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  33  7..........RLLDVLGNETRRRILFLLTKRPYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIPRGRPRKYY................................................................................................................ 74
3 -26.100d2lkpa_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  19  14LDSQAAAQVASTLQALATPSRLMILTQLRNGPLPVTDLAEAIGMEQSAVSHQLRVLRNLGLVVGDRAGR-----SIVYSLYDTHVA........................................................................................................ 94
4 -25.600d2jsca_ a.4.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  22  2.........ARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGR-----QVRYALADSHLA........................................................................................................ 73
5 -24.400d3gw2a_ a.4.5.0 (A:) automated matches {Mycobacterium bovis [TaxId: 233413]}  ali model 3D-neighbors follow..  25  2.KAALLDQVARVGKALANGRRLQILDLLAQGERAVEAIATATGMNLTTASANLQALKSGGLVEARREGT-----RQYYRIAGEDV......................................................................................................... 80
6 -23.800d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]}  ali model 3D-neighbors follow..  18  5IAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGR-----HVYYQLQDHHI......................................................................................................... 84
7 -23.300d1y0ua1 a.4.5.5 (A:1-87) Putative arsenical resistance operon repressor AF0168 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  17  20.........KRYNYAVTNPVRRKILRMLDKG-RSEEEIMQTLSLSKKQLDYHLKVLEAGFCIERVGER.......................................................................................................................... 77
8 -22.900d3pqka_ a.4.5.0 (A:) automated matches {Xylella fastidiosa [TaxId: 2371]}  ali model 3D-neighbors follow..  21  11.........ANLLKTLSHPVRLMLVCTLVEGEFSVGELEQQIGIGQPTLSQQLGVLRESGIVETRRNIK-----QIFYRLTEAKA......................................................................................................... 81
9 -22.700d4ggga_ a.4.5.5 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}  ali model 3D-neighbors follow..  23  7.........TEIFKALGDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSAHVVKAKRQGQ-----SMIYSLDDIHV......................................................................................................... 77
10 -22.500d4k2ea_ a.4.5.0 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}  ali model 3D-neighbors follow..  22  12.........VVLLKAMANERRLQILCMLLDNELSVGELSSRLELSQSALSQHLAWLRRDGLVNTRKEAQT------FYTLSSTEV......................................................................................................... 82
11 -22.000d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  21  22.........SQILKAIADENRAKITYALQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKL------LYSLGDEHIR........................................................................................................ 94
12 -20.300d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Pyrococcus horikoshii [TaxId: 53953]}  ali model 3D-neighbors follow..  21  1...MEELKEIMKSHILGNPVRLGIMIFLLPRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYKV........................................................................................................................... 65
13 -16.900d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  1...................MKNEILEFLNRNGGKTAEIAEALAVTDYQARYYLLLLEKAGMVQRSPLRR--GMATYWFLKGEKQ.......................................................................................................... 64
14 -16.500d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]}  ali model 3D-neighbors follow..  30  20.................TDTDVAVLLKMIEKPITSEELADIFKLSKTTVENSLKKLIELGLVVRTKTEGKKIGRPKYYYSISS........................................................................................................... 87
15 -15.200d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Methanococcus jannaschii [TaxId: 2190]}  ali model 3D-neighbors follow..  21  25.................NKSVGAVYAILSDKPLTISDIMEELKISKGNVSMSLKKLEELGFVRKVWIK---GERKNYYEAVDG........................................................................................................... 89
16 -13.800d2heoa_ a.4.5.19 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  21  1.................DNLEQKILQVLSDGPVAIFQLVKKCQVPKKTLNQVLYRLKKEDRVSSPSPKY......................................................................................................................... 54
17 -13.100d5x14a1 a.4.5.0 (A:1-182) automated matches {Bacillus subtilis [TaxId: 655816]}  ali model 3D-neighbors follow..  23  2.................RVLKYAILGLLRKGELSGYDITSYFKAKHSQIYPELKKLTDEGFITFRTTIQGTKLEKKMYTLTDSG.......................................................................................................... 76
18 -12.900d1yg2a_ a.4.5.61 (A:) Hypothetical protein AphA {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  22  1..................SLPHVILTVLSTRDATGYDITKEFSASHQQVYRELNKMGEQGLVTCVLEPQEGKPDRKVYSITQAG.......................................................................................................... 74
19 -12.700d1qzza1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  14  22.............MALRVAATLRLVDHLLAGADTLAGLADRTDTHPQALSRLVRHLTVVGVLEGGEKQ.......................................................................................................................... 76
20 -12.700d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]}  ali model 3D-neighbors follow..  18  8................IFSLVKKEVLSLNTDYTTAISLSNRLKINKKKINQQLYKLQKEDTVKMVPSNP......................................................................................................................... 61
21 -12.600d3elka_ a.4.5.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  19  4.............RILHGLITLYILKELVKRPMHGYELQKSMFLPQGSIYILLKTMKERGFVISESSVNEKGQQLTVYHITDAG.......................................................................................................... 80
22 -12.300d4gcva_ a.4.5.0 (A:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}  ali model 3D-neighbors follow..  18  4.........ARSLERVGEWWSILIMRDALQGLRRFDEFSRSLDIAPNMLTRRLNALVEAGLLERQPYSQRPLRYQ--YVPTAKGEDF....................................................................................................... 79
23 -12.100d1sfxa1 a.4.5.50 (A:1-106) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  16  10..........KALEKLSKPSDVRISLLLERGGMRVSEIARELDLSARFVRDRLKVLLKRGFVRREIVEKGW....................................................................................................................... 72
24 -11.800d2obpa1 a.4.5.71 (A:12-92) Putative DNA-binding protein ReutB4095 {Ralstonia eutropha [TaxId: 106590]}  ali model 3D-neighbors follow..  12  3.................DPAIVEVLLVLGATPWSLPKIAKRAQLPMSVLRRVLTQLQAAGLADVSVEADGRGHAS................................................................................................................... 67
25 -11.600d1oyia_ a.4.5.19 (A:) dsRNA-binding protein E3 (E3L) {Vaccinia virus [TaxId: 10245]}  ali model 3D-neighbors follow..  11  1.................RSNAEIVCEAIKTIGATAAQLTRQLNMEKREVNKALYDLQRSAMVYSSDDIPP------RWFMTT............................................................................................................ 62
26 -11.600d4esfa1 a.4.5.0 (A:3-105) automated matches {Bacillus cereus [TaxId: 222523]}  ali model 3D-neighbors follow..  13  1..........NLTEMLKGSLEGCVLEIISRRETYGYEITRHLNVVEGTVYTILVRLEKKKLVNIEKKPSDMGPPRKFYSLNEAG.......................................................................................................... 80
27 -11.500d3f8ba_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}  ali model 3D-neighbors follow..  15  3.............EMLRAQTNVILLNVLKQGDNYVYGIIKQVKLNEATLYTIFKRLEKDGIISSYWGDESQGGRRKYYRLTEIG.......................................................................................................... 81
28 -11.400d2f2ea1 a.4.5.69 (A:5-146) Hypothetical protein PA1607 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  13  11.........ARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRNLVEHGVMVAVPAES----SHQEYRLTDKGRAL....................................................................................................... 85
29 -11.300d1bm9a_ a.4.5.7 (A:) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  12  17...................LKLYMITMTEQERLYGLKLLEVLRSNHTEVYRSLHELLDDGILKQIKVKKEGAKLQVLYQFKDYE.......................................................................................................... 92
30 -11.100d2esha1 a.4.5.61 (A:4-117) Hypothetical protein TM0937 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  23  11...................LASTILLLVAEKPSHGYELAERLAEHMGNIYRVLADLEESGFLS-TEWDTTVSPPRKIYRITPQG.......................................................................................................... 83
31 -11.100d5h20a_ a.4.5.0 (A:) automated matches {Bacteroides fragilis [TaxId: 272559]}  ali model 3D-neighbors follow..  21  1........DNVKSQMRKGMLEYCIMLLLHKEPAYASDIIQKLKVVEGTLYPLLTRLKNDDLLSYEWVESTQGPPRKYYKLTGKG.......................................................................................................... 81
32 -10.900d1qbja_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  25  1..............SIYQDQEQRILKFLEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGT.......................................................................................................................... 58
33 -10.800d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  24  9....................KIKEAAEASNAYLTSSKLADMLGISQQSASRIIIDLEKNGYITRTVTKR......................................................................................................................... 58
34 -10.800d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  31  2...............LIDNLDRGILEALMNARTAYAELAKQFGVSPETIHVRVEKMKQAGIIT............................................................................................................................... 50
35 -10.700d1xmka1 a.4.5.19 (A:294-366) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  19  5..................EIKEKICDYLFNVDSSALNLAKNIGLKARDINAVLIDMERQGDVYRQGTTP......................................................................................................................... 57
36 -10.600d4awxb1 a.4.5.62 (B:1-79) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  20  5.....................MEVRDMLALGRMEAKQLSARLQTPQPLIDAMLERMEAMGKVVRISETS......................................................................................................................... 53
37 -10.500d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  18  43....................EHHILWIAQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRLN......................................................................................................................... 92
38 -10.500d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  14  31.................KTTELYAFLYVLFGPKKMKEIAEFLSTTKSNVTNVVDSLEKRGLVVREMDPVDRRTTEKGKEIFGEILSNFESLLKSVLEKFSEEDFKVVSEGFNRMVEALSRE..................................................................... 140
39 -10.500d2pn6a1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]}  ali model 3D-neighbors follow..  21  2.................DEIDLRILKILQNAKYSLDEIAREIRIPKATLSYRIKKLEKDGVIK............................................................................................................................... 48
40 -10.400d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  26  4.......................ILKRIMKSPVSRVELAEELGLTKTTVGEIAKIFLEKGIVVEEKDSPKGVGRPT.................................................................................................................. 56
41 -10.300d2p5va1 a.4.5.0 (A:3-65) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  32  1.............QLTLDKTDIKILQVLQNGRLTNVELSERVALSPSPCLRRLKQLEDAGIVR............................................................................................................................... 51
42 -10.300d2hr3a1 a.4.5.28 (A:2-146) Probable transcriptional regulator PA3067 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  14  33.................QFSQLVVLGAIDRGDVTPSELAAAERMRSSNLAALLRELERGGLIVRHAD........................................................................................................................... 84
43 -10.200d1z7ua1 a.4.5.69 (A:1-108) Hypothetical protein EF0647 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  16  12...........ALSTINGKWKLSLMDELFQGTKRNGELMRALGITQRVLTDRLREMEKDGLVHRESFNELPPRVE--YTLTPEGYAL....................................................................................................... 86
44 -10.200d4hw0a_ a.4.5.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}  ali model 3D-neighbors follow..  16  7...................IMFDILRNC-EPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTEND-----RKIYEITEKGKLL....................................................................................................... 68
45 -10.100d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  4.................DQIDLNIIEELKDSRLSMRELGRKIKLSPPSVTERVRQLESFGIIK............................................................................................................................... 50
46 -10.100d1s3ja_ a.4.5.28 (A:) Putative transcriptional regulator YusO {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  34.................TPAQLFVLASLKHGSLKVSEIAERMEVKPSAVTLMADRLEQKNLIARTHNTK......................................................................................................................... 86
47 -10.100d5dyma_ a.4.5.0 (A:) automated matches {Peptoclostridium difficile [TaxId: 645463]}  ali model 3D-neighbors follow..  16  3...................IDILIVSILEKKDCYGYEIAKQVRLKEGTMYLALKRMESKNLIKSYSNEQSSGGRRKYYNLTNEG.......................................................................................................... 74
48 -10.000d3l7wa_ a.4.5.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}  ali model 3D-neighbors follow..  21  2........YYPVSALLIEYL---ILAIVSKHDSYGYDISQTISIKESTLYPILKKLEKAGYLS-TYTQEHQGRRRKYYHLTDSG.......................................................................................................... 77
49 -9.960d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  35....................EFTILAIINKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTE......................................................................................................................... 86
50 -9.930d5hs7a1 a.4.5.0 (A:5-105) automated matches {Bacillus subtilis [TaxId: 224308]}  ali model 3D-neighbors follow..  11  7..........SAFSLLGKRWNGLIIHVLMDGPKRFKEITETIMISQKMLAERLKELEQNEIVERQVLPETPVKVI--YTLTEKGTAL....................................................................................................... 82
51 -9.930d3k2za1 a.4.5.0 (A:3-71) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  18  4..................ERQRKVLLFIEE-PPSVREIARRFRITPRGALLHLIALEKKGYIERKNGKPRA....................................................................................................................... 62
52 -9.880d1yyva1 a.4.5.69 (A:9-122) Putative transcriptional regulator YtfH {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  21  16..........EVLKHVTSRWGVLILVALRDGTHRFSDLRRKMGVSEKMLAQSLQALEQDGFLNRVSYPVVPPHVE--YSLTPLGEQV....................................................................................................... 91
53 -9.880d3mexa_ a.4.5.28 (A:) MexR repressor {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  19  37..................PPDVHVLKLIDEQRLNLQDLGRQMCRDKALITRKIRELEGRNLVRRERNPS......................................................................................................................... 88
54 -9.870d2a61a1 a.4.5.28 (A:5-143) Transcriptional regulator TM0710 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  15  29.................TPAQFDILQKIFEGPKRPGELSVLLGVAKSTVTGLVKRLEADGYLTRTPDPADRRATRKGEEVIEKVIERRENFIEKITSDLGKEKSSKILDYLKELKGVMERN..................................................................... 138
55 -9.860d2fswa1 a.4.5.69 (A:3-104) Hypothetical protein PG0823 {Porphyromonas gingivalis [TaxId: 837]}  ali model 3D-neighbors follow..  14  12..........KSMQIFAGKWTLLIIFQINRRIIRYGELKRAIGISEKMLIDELKFLCGKGLIKKKQYPEVPPRVE--YSLTPLGEKV....................................................................................................... 87
56 -9.860d2co5a1 a.4.5.48 (A:5-93) STIV F93 {Sulfolobus turreted icosahedral virus [TaxId: 269145]}  ali model 3D-neighbors follow..  10  8...................YIILKVLVINGSRLEKKRLRSEILKSDGVLYPLIDSLIDDKILREEEAPD-----GKVLFLTEKG.......................................................................................................... 73
57 -9.760d4hbla1 a.4.5.0 (A:1-145) automated matches {Staphylococcus epidermidis [TaxId: 176279]}  ali model 3D-neighbors follow..  14  36...............ITYSQYLVMLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRLTDNGQQQQEAVFEAISSCLPQEFDTTEYDETKYVFEELEQTLKHLIE...................................................................... 145
58 -9.750d2gmga1 a.4.5.82 (A:10-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]}  ali model 3D-neighbors follow..  25  3...................RREKIIELLLEGDYSPSELARILDMSKKVILEDLKVISKI................................................................................................................................... 46
59 -9.730d3k69a_ a.4.5.0 (A:) automated matches {Lactobacillus plantarum [TaxId: 1590]}  ali model 3D-neighbors follow..  16  8...........AVHSIL------YLDAHRDSKVASRELAQSLHLNPVMIRNILSVLHKHGYLTGTVGKNGGYQLDL.................................................................................................................. 66
60 -9.710d1jmrb3 a.4.5.33 (B:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  18  8.....................FEILDFIVKNDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKR--------YVPGYKLIEYG...................................................................................................... 68
61 -9.700d3bjaa1 a.4.5.0 (A:1-138) automated matches {Bacillus cereus [TaxId: 222523]}  ali model 3D-neighbors follow..  19  31.................SYVQFGVIQVLKSGKVSMSKLIENMGCVPSNMTTMIQRMKRDGYVMTEKNPN......................................................................................................................... 83
62 -9.600d1p4xa1 a.4.5.28 (A:1-125) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  14  36....................EFILLTYLFHNTLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKI......................................................................................................................... 87
63 -9.500d4mtea_ a.4.5.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  25  23..................PQRLEVLRLMQDGAISAYDLLDLLQAKPPTVYRALDFLLEQGFVHKVE............................................................................................................................ 77
64 -9.500d5eria1 a.4.5.0 (A:22-168) automated matches {Peptoclostridium difficile [TaxId: 1496]}  ali model 3D-neighbors follow..  13  36....................QFTFLTRICENPINLVELSNMLKVDKATTTKAIQKLIKAGYVDKKQDKFDKRGTDKSLEVYELIIEEENRSIEICFDNFTDEEKQVVTKLLEKMSKNVENE..................................................................... 142
65 -9.480d3e6ma_ a.4.5.0 (A:) automated matches {Silicibacter pomeroyi [TaxId: 89184]}  ali model 3D-neighbors follow..  20  45....................KLRLLSSLSAGELTVGQLATLGVMEQSTTSRTVDQLVDEGLAARSISDA......................................................................................................................... 94
66 -9.480d4e70a1 a.4.5.0 (A:1-112) automated matches {Linum nodiflorum [TaxId: 407264]}  ali model 3D-neighbors follow..  13  27.............MTLQCALELDIADVIHRHPIPLNQLAAALEIPQTKLSRLMRMLVHLGYFTQVKPEDENDDVLPSYWLAP............................................................................................................ 102
67 -9.430d4a5na_ a.4.5.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  13  6..........FTLDVIGGKWKGILFYHMIDGKKRFNEFRRICSITQRMLTLQLRELEADGIVHREVYHQVPPKVE--YSLTEFGRTL....................................................................................................... 81
68 -9.360d2frha2 a.4.5.28 (A:102-224) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  35....................EFAVLTYIKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEH......................................................................................................................... 86
69 -9.340d3df8a1 a.4.5.0 (A:1-106) automated matches {Thermoplasma volcanium [TaxId: 50339]}  ali model 3D-neighbors follow..  17  16..........SVLHLLGKKYTMLIISVLGNGSTRQNDIRSSIGISSTILSRRIKDLIDSGLVERRSGQITT------YALTEKGMNV....................................................................................................... 89
70 -9.310d1z91a1 a.4.5.28 (A:8-144) Organic hydroperoxide resistance transcriptional regulator OhrR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  20  31...............ITYPQYLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLKRMEQQGLITRKRSEE......................................................................................................................... 84
71 -9.300d4gxoa1 a.4.5.0 (A:7-141) automated matches {Staphylococcus aureus [TaxId: 426430]}  ali model 3D-neighbors follow..  16  30...............LTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEK......................................................................................................................... 83
72 -9.250d2fbia1 a.4.5.28 (A:5-140) Probable transcriptional regulator PA4135 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  16  32....................QWRVIRILQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPK......................................................................................................................... 81
73 -9.230d1hsja1 a.4.5.28 (A:373-487) Staphylococcal accessory regulator A homolog, SarR {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  20  34....................EIYILNHIESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQ......................................................................................................................... 85
74 -9.230d2bv6a1 a.4.5.28 (A:6-140) Transcriptional regulator MgrA {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  11  31...............LTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEV......................................................................................................................... 84
75 -9.210d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}  ali model 3D-neighbors follow..  10  9.....................QAILEAC-KSGSPKTRIMYGANLSYALTGRYIKMLMDLEIIRQEGKQ---------YMLTKKGEEL....................................................................................................... 64

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.