current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70
# Score Template Links and tools%idFirst MEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSDLast
1 -48.200d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]}  ali model 3D-neighbors  100  1MEKSIITQKIIAKAFKDLMQSNAYHQISVSDIMQTAKIRRQTFYNYFQNQEELLSWIFENDFAELINDNSD 71
2 -27.100d1ui5a1 a.4.1.9 (A:5-75) A-factor receptor homolog CprB {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  23  2..RAEQTRATIIGAAADLFDRRGYESTTLSEIVAHAGVTKGALYFHFAAKEDLAHAILEIQSRTSRRLAKD 70
3 -27.000d3q0wa1 a.4.1.0 (A:22-94) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  24  4......RELAILATAENLLEDRPLADISVDDLAKGAGISRPTFYFYFPSKEAVLLTLLDRVVNQADMALQT 68
4 -26.800d2fd5a1 a.4.1.9 (A:1-76) Probable transcriptional regulator PA3133 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  21  3.DKKTQTRARILGAATQALLERGAVEPSVGEVMGAAGLTVGGFYAHFQSKDALMLEAFEQLLGKRRELLGE 72
5 -26.200d3c07a1 a.4.1.9 (A:15-89) Putative transcriptional regulator SCO4850 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  24  1.SKSEQTRALILETAMRLFQERGYDRTTMRAIAQEAGVSVGNAYYYFAGKEHLIQGFYDRIAAEHRAAVRE 70
6 -26.100d3br0a1 a.4.1.9 (A:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  2......LKDKILGVAKELFIKNGYNATTTGEIVKLSESSKGNLYYHFKTKENLFLEILNIEESKWQEQWKS 66
7 -25.700d2hyja1 a.4.1.9 (A:8-82) Putative transcriptional regulator SCO4940 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  10  1.AEAQATRGRILGRAAEIASEEGLDGITIGRLAEELEMSKSGVHKHFGTKETLQISTLDKAFVDFWHRVVE 70
8 -25.200d1vi0a1 a.4.1.9 (A:6-77) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  29  3.......YMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYFKNKEDILISLFKEKMGQFIERMEE 66
9 -24.900d2g3ba1 a.4.1.9 (A:2-73) Putative transcriptional regulator {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  16  3......RRDAILKASATAIAQRGIRGLRVNDVAEVAGVSPGLLYYHFKDRIGLLEAALNYINDRARAYRSE 67
10 -24.500d2id6a1 a.4.1.9 (A:1-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  19  1...MLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFEN 68
11 -24.300d2o7ta1 a.4.1.9 (A:1-78) Transcriptional regulator Cgl1640/Cg1846 {Corynebacterium glutamicum [TaxId: 1718]}  ali model 3D-neighbors follow..  14  5...ALKRREHIITTTCNLYRTHHHDSLTMENIAEQAGVGVATLYRNFPDRFTLDMACAQYLFNVVISLQLQ 72
12 -24.300d2gena1 a.4.1.9 (A:6-75) Probable transcriptional regulator PA1836 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  10  2.......KDEILQAALACFSEHGVDATTIEMIRDRSGASIGSLYHHFGNKERIHGELYLAGIGQYAALLEA 65
13 -24.100d2yvea1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}  ali model 3D-neighbors follow..  12  5......KKEMILRTAIDYIGEYSLETLSYDSLAEATGLSKSGLIYHFPSRHALLLGMHELLADDWDKELRD 69
14 -23.900d1rkta1 a.4.1.9 (A:2-82) Hypothetical transcriptional regulator YfiR {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  21  7.EHKDKRQAEILEAAKTVFKRKGFELTTMKDVVEESGFSRGGVYLYFSSTEEMFRRIIETGLDEGLRKLDK 76
15 -23.900d2g7sa1 a.4.1.9 (A:3-76) Putative transcriptional regulator Atu0279 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  18  5......KADDILQCARTLIIRGGYNSFSYADISQVVGIRNASIHHHFPSKSDLVCKLVSQYRQEAEAGIAE 69
16 -23.700d2np5a1 a.4.1.9 (A:9-77) Transcriptional regulator RHA1_ro04179 {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  15  2......SPERLAAALFDVAAESGLEGASVREVAKRAGVSIGAVQHHFSTKDEMFAFALRTLVDKLLARLSE 66
17 -23.600d2fbqa1 a.4.1.9 (A:2-80) Transcriptional regulator PsrA {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  15  5......TVERILDAAEQLFAEKGFAETSLRLITSKAGVNLAAVNYHFGSKKALIQAVFSRFLGPFCASLEK 69
18 -23.500d2id3a1 a.4.1.9 (A:13-80) Putative transcriptional regulator SCO5951 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  10  3..RTARIREAVLLAAGDALAADGFDALDLGEIARRAGVGKTTVYRRWGTPGGLAADLLADMAEQSL..... 66
19 -23.200d2jj7a1 a.4.1.9 (A:3-76) automated matches {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  23  1.ASREQTMENILKAAKKKFGERGYEGTSIQEIAKEAKVNVAMASYYFNGKENLYYEVFKKYGLAN...... 64
20 -23.000d2d6ya1 a.4.1.9 (A:7-74) Putative regulator SCO4008 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  20  2.....ATKARIFEAAVAEFARHGIAGARIDRIAAEARANKQLIYAYYGNKGELFASVLEKKMLDLAIS... 64
21 -22.900d4jyka1 a.4.1.9 (A:12-86) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  15  4..AVSAKKKAILSAALDTFSQFGFHGTRLEQIAELAGVSKTNLLYYFPSKEALYIAVLRQILDIWLAPLKA 72
22 -22.800d2oi8a1 a.4.1.9 (A:8-86) Putative regulatory protein Sco4313 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  12  10......VRAEIKDHAWEQIATAGASALSLNAIAKRMGMSGPALYRYFDGRDELITELIRDAYRSQADSLRA 74
23 -22.200d2fq4a1 a.4.1.9 (A:9-77) Transcriptional regulator BC3163 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  24  1..RNIETQKAILSASYELLLESGFKAVTVDKIAERAKVSKATIYKWWPNKAAVVMDGFLSAAAARLP.... 65
24 -21.700d1sgma1 a.4.1.9 (A:5-77) Putative transcriptional regulator YxaF {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  18  3......SREKILHTASRLSQLQGYHATGLNQIVKESGAPKGSLYHFFPNKEELAIEAVTYTGKIVEHLIQQ 68
25 -21.600d2xpwa1 a.4.1.9 (A:3-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  16  1....RLNRESVIDAALELLNETGIDGLTTRKLAQKLGIEQPTLYWHVKNKRALLDALAVEILARH...... 61
26 -21.200d2g7la1 a.4.1.9 (A:16-83) Putative transcriptional regulator SCO7704 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  17  1..KPALSRRWIVDTAVALMRAEGLEKVTMRRLAQELDTGPASLYVYVANTAELHAAVLDALLGEV...... 63
27 -21.000d2hkua1 a.4.1.9 (A:18-87) Putative transcriptional regulator RHA1_ro03468 {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  13  1.....QTRDALFTAATELFLEHGEG-VPITQICAAAGAHPNQVTYYYGSKERLFVEVACAAVLRAGKRAED 65
28 -20.700d2np3a1 a.4.1.9 (A:35-99) Putative transcriptional regulator SCO0857 {Streptomyces coelicolor [TaxId: 1902]}  ali model 3D-neighbors follow..  16  1..........ILTAARVCFAERGFDATSLRRIAETAGVDQSLVHHFYGTKENLFLQALELPGKIE...... 55
29 -20.100d1zk8a1 a.4.1.9 (A:6-77) Transcriptional regulator BC5000 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  15  4......TLQKIVETAAEIADANGVQEVTLASLAQTLGVRSPSLYNHVKGLQDVRKNLGIYGIKKL...... 62
30 -19.900d2gfna1 a.4.1.9 (A:4-80) Probable transcriptional regulator RHA1_ro04631 {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  12  6.....ERRRALADAVLALIAREGISAVTTRAVAEESGWSTGVLNHYFGSRHELLLAALRRAGDIQGDRYRT 71
31 -19.800d1t33a1 a.4.1.9 (A:1-88) Putative transcriptional repressor YbiH {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  15  8.TKGEQAKSQLIAAALAQFGEYGLHA-TTRDIAALAGQNIAAITYYFGSKEDLYLACAQWIADFLGEKFRP 76
32 -19.000d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  20  3......SKDTIIAAAFSLLEKPTLEQLSMRKVAKQLGVQAPAIYWYFKNKQALLQSMAEAIEEHF...... 62
33 -16.700d2g7ga1 a.4.1.9 (A:9-73) Putative transcriptional regulator Rha04620 {Rhodococcus sp. RHA1 [TaxId: 101510]}  ali model 3D-neighbors follow..  12  2......DRERIAEAALELVDRDG--DFRMPDLARHLNVQVSSIYHHAKGRAAVVELVRHRVVREI...... 58
34 -15.600d2i10a1 a.4.1.9 (A:10-78) Putative transcriptional regulator RHA1_ro09068 {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  15  2.......DQVALQTAMELFWRQGYEGTSITDLTKALGINPPSLYAAFGSKRDLFEKTLD............ 53
35 -14.600d2ao9a1 a.4.1.17 (A:13-132) Phage protein BC1890 {Bacillus cereus [TaxId: 1396]}  ali model 3D-neighbors follow..  11  13..TAKQIQAAYLLVENELMESNNEEKRTQDEMANELGINRTTLW-EWRTKNQDFIAFKSEVADSFLAEKRE 80

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.