current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYHLast
1 -70.100d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}  ali model 3D-neighbors  100  1VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYH 146
2 -60.800d1naza_ a.1.1.2 (A:) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}  ali model 3D-neighbors follow..  19  1MVLSEGEWQLVLHVWAKVEADGHGQDIYIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKQGVRVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYK 148
3 -59.200d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  40  1VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKR----------TDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH 136
4 -59.000d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  30  1VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSAN----DIGVQQHADKVQRALGEAIDDLKKVEINFQNL-SGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH 141
5 -58.500d2w72a_ a.1.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  31  2..LSPADKTNVKAAWGKVGAHEYGAEAYERMFLSFPTTKTYFPHF------DLSHGSAQVKGQGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR 141
6 -57.200d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  29  1.AFTACEKQTIGKIAQVLAKSAYGAECLARLFVTHPGSKSYFEYK------DYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTE-FSPDTHCAVDKLLSAICQELSSRYR 140
7 -56.500d2dc3a_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  24  2.ELSEAERKAVQAMWARLYANDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRKHACRVMGALNTVVENLHDVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYK 151
8 -53.300d3pt8a_ a.1.1.0 (A:) automated matches {Clam (Lucina pectinata) [TaxId: 244486]}  ali model 3D-neighbors follow..  11  2.TLTNPQKAAIRSSWSKFMDNSNGQGFYMDLFKAHPETLTPFKSLFGGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIMAKLHNNRGIRASDLRTAYDILIHYMED--HNHMVGGAKDAWEVFVGFICKTLGDYMK 148
9 -53.200d3qm9a_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}  ali model 3D-neighbors follow..  27  1.....ADFDAVLKCWGPVEADTIGGLVLTRLFKEHPETQKLFPKFAGIA-QADIAGNAAVSAHGATVLKKLGELLKAKGSHAAILKPLANSHATKHKIPINNFKLISEVLVKVMQEKAG--LDAGGQTALRNVMGIIIADLEANYK 140
10 -52.500d3qqqa_ a.1.1.2 (A:) automated matches {Trema tomentosa [TaxId: 3480]}  ali model 3D-neighbors follow..  11  2..FTEEQEALVVKSWAVMKKNELGLKFFLKIFEIAPSAKNLFSYLKDSP--IPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSEMK 150
11 -52.300d1q1fa_ a.1.1.2 (A:) Neuroglobin {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  18  1....RPESELIRQSWRVVSRSEHGTVLFARLFALEPSLLPLFQYNRQFSSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWD 147
12 -51.500d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}  ali model 3D-neighbors follow..  17  1.GLTAAQIKAIQDHWFLNCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYG-LRSNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFS--ADPTTVAAWGDAAGVLVAAMK.... 141
13 -50.900d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  17  10GDLTLAQKKIVRKTWHQLMRNSFVTDVFIRIFAYDPSAQNKFPQMAGMSASQ-LRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATL-ARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKH. 156
14 -50.400d1x3ka_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}  ali model 3D-neighbors follow..  14  3VGLSDSEEKLVRDAWAPIHGDGTANTVFYNYLKKYPSNQDKFETLKGHPLDE-VKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIMSGPHVARPITHGSYNDLRGVIYDSMH------LDSTHGAAWNKMMDNFFYVFYECLD 145
15 -50.200d1mbaa_ a.1.1.2 (A:) Myoglobin {Slug sea hare (Aplysia limacina) [TaxId: 6502]}  ali model 3D-neighbors follow..  13  1.SLSAAEADLAGKSWAPVFANANGLDFLVALFEKFPDSANFFADFKGKSVAD-IKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLFAKEHVGFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKAAG. 145
16 -49.700d1b0ba_ a.1.1.2 (A:) Hemoglobin I {Clam (Lucina pectinata) [TaxId: 244486]}  ali model 3D-neighbors follow..  1.SLSAAQKDNVKSSWAKASAATAGPEFFMALFDAHDDVFAKFSGLFSGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCFAANHKARGISAGQLEAAFKVLAGFMKSYGGD------EGAWTAVAGALMGMIRPDM. 142
17 -49.300d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  13  1..LSADQISTVQASFDKVKGD--PVGILYAVFKADPSIMAKFTQFAGKD-LESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTF-VASHKPRGVTHDQLNNFRAGFVSYMKAHTD---FAGAEAAWGATLDTFFGMIFSKM. 136
18 -48.800d2bk9a_ a.1.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}  ali model 3D-neighbors follow..  16  1..MNSDEVQLIKKTWEIPVATDSGAAILTQFFNRFPSNLEKFP-FRDVPLEE-LSGNARFRAHAGRIIRVFDESIQVLGQDGDLIWTKIAVSHIPRTVSKESYNQLKGVILDVLTA--ASSLDESQAATWAKLVDHVYAIIFKAID 147
19 -48.600d2c0ka_ a.1.1.0 (A:) automated matches {Gasterophilus intestinalis [TaxId: 84525]}  ali model 3D-neighbors follow..  18  1..MNSEEVNDIKRTWEVVAAKEAGVEMLKRYFKKYPHNLNHFPWFKEIP-FDDLPENARFKTHGTRILRQVDEGVKALSVFDDVWKKL-AQTHHEKKVERRSYNELKDIIIEVVCSCVK--LNEKQVHAYHKFFDRAYDIAFAEMA 148
20 -47.900d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  14  1.GLSAAQRQVVASTWKDIAGAGVGKECLSKFISAHPEMAAVFGFSG--------ASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQ 146
21 -47.600d3g46a_ a.1.1.2 (A:) Hemoglobin I {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}  ali model 3D-neighbors follow..  20  8AQLTADVKKDLRDSWKVIGSDGNGVALMTTLFADNQETIGYFKRLGDV---SQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL..... 146
22 -47.600d1x46a_ a.1.1.0 (A:) automated matches {Tokunagayusurika akamusi [TaxId: 28383]}  ali model 3D-neighbors follow..  13  5VDMEAGDIALVKSSWAQIHDK--EVDILYNFFKSYPASQAKFSAFAGKDLES-LKDTAPFALHATRIVSVINEAIALMGVAENRVLKQQGINHKGRGVTAAHFEEFETALEAFLES-HASGYNAGTKKAWDSAFNNMYSVVFPEL. 150
23 -46.400d2zs0b_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  14  1.DCTSLNRLLVKRQWAEANRELLGNRIWEDLFANMPDARGLFSRV-----NGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDN--DAWNSCMNQIVSGISG... 142
24 -46.300d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  21  9PTLTDGDKKAINKIWPKIYKEQYSLNILLRFLKCFPQAQASFPKFST--KKSNLEQDPEVKHQAVVIFNKVNEIINSMDNIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGA----------EFEKLFSIICILLRSAY. 146
25 -46.000d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  12  1.TLTKHEQDILLKELGPHHIVETGLGAYHALFTAHPQYISHFSRLEGHTIEN-VMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAEKFLKHVFPMMAAEI..... 147
26 -45.800d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  15  1..MTREEIKMIQKSWLRVIDDEAGLLFYRRLFDVEPKVRPLF--------------KIDIEKQGRKLMDVLNWIVLNLQDIDAALDAALARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEEH. 133
27 -45.800d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  1.ECLVTESLKVKLQWASAERVAFGLELWRDIIDDHPEIKAPFSRV-----RGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFG---AWHDCVDQIIDGIK.... 140
28 -45.600d3ubca_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  16  1..IDQKEKELIKESWKRIEPNEIGLLFYANLFKEEPTVSVLF--------------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTA... 131
29 -45.200d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  5..CSEEDHRIVQKQWDILWRDGFGRLLLTKLAKDIPEVNDLFKRV-----DIEHAEGPKFSAHALRILNGLDLAINLLDDLDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLD----DYDALAWKSCLKGILTKISSRL. 149
30 -44.600d2zs0d_ a.1.1.0 (D:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  16  3..CSRGDAEVVISEWDQVSESAIGVAIFDVFFTSSGVSPSMFPGGGDS-------SSAEFLAQVSRVISGADIAINSLTNCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHI----DAWGYCMAYIAAGIGAGL. 145
31 -44.100d2zs0c_ a.1.1.0 (C:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  13  4..CSSEDRANVMHNWDAARRVALAQAVFASLFSRDAAAQGLFSGV-----SADNPDSADFRAHCVRVVNGLDVAINMLNDLNEQLAHLSAQHQARAGVAAAHFDVMAEAFAEVMPQV----SSCFSSDSWNRCFARIANGISAGL. 147
32 -43.500d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  13  2..LTQKTKDIVKATAPVLAEYDIIKCFYQRMFEAHPELKNVFN-----------MAHQEQGQQQQALARAVYAYAENIEDPNSLMAVLIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMGMES 138
33 -43.300d2wtga_ a.1.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}  ali model 3D-neighbors follow..  3..NRQEISDLCVKSLEGRQNIENGNAFYRYFFTNFPDLRVYFKGAEKYT-ADDVKKSERFDKQGQRILLACHLLANVYTNEEVFKGYVTINRHRIYKMDPALWMAFFTVFTGYLESVGS--LNDQQKAAWMALGKEFNAESQTHLK 151
34 -43.300d2zs0a_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  16  2..CNRLEQILVKTQWAQSNRAAFSRDLFSELFNIQGSSRALFSGV-----GVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLLAGQHASRNLDASNFAAMGQAVMSVVPTHLD----CFNQHAWGECYERIASGISG... 140
35 -43.300d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  15  1...ANKTRELCMKSLEHAEARQDGIDLYKHMFENYPPLRKYFKSREEYT-AEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTLLDRHARDHVHMPPETDFWKLFEEYLGK--KTTLDEPTKQAWHEIGREFAKEINK... 147
36 -42.500d3wctd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}  ali model 3D-neighbors follow..  17  2..CSEADATIVIKQWNQISRWTMGNEIFSSLFKLKPESEVLFNNV-----NVANMSSGAFHAHTVRVLSGLDMGINYLNDLTSLTAHLAAQHVARTGLKAVYFDAMGKVLMTVLPS-LIDNFNPD---AWRNCLLPLKNAIAKGL. 146
37 -41.900d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  12  1...TKEQIQIIKDCVPILQKEDLTNEFYKIMFNDYPEVKPMFN-----------MEKQISGEQPKALAMAILMAAKNIENLENMRSFVVAITHVNLGVKEEHYPIVGACLLKAIKNLLN--PDEATLKAWEVAYGKIAKFYIDIEK 134
38 -41.800d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]}  ali model 3D-neighbors follow..  16  2..........FKQDIATIRGDTYAQDIFLAFLNKYPDERRYFKNYVGKSDQE-LKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDALVQMKQHSSLTTGNFEKFFVALVEYMRAS----GQSFDSQSWDRFGKNLVSALSSAGM 136
39 -36.300d2xkia_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  11  2............VNWAAV-----VDDFYQELFKAHPEYQNKFG-----VALGSLKGNAAYKTQAGKTVDYINAAIGGSADAAGL-----ASRHKGRNVGSAEFHNAKACLAKAC----SAHGAPDLGHAIDDILSHL......... 110
40 -35.700d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  1.....NAADRVMQSYGRCASTGFFDDFYRHFLASSPQIRAKFA-------------TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGHSRAALDIRPELYDLWLDALLMAVAEHDRD-CDAETRDAWRDVMGRGIAVIKSYY. 129
41 -9.230d2ig3a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  12.......AKLMEIFYEKVRKD--------------KDLGPIFNNAIGTSDEE-------WKEHKAKIGNFWAGMLLGEGDYNG---QPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYK... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 6 9 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.