current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP207

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
3 -59.200d1gcvb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  40  1VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKR----------TDFRSSIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCIIVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH 136
4 -59.000d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}  ali model 3D-neighbors follow..  30  1VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSAN----DIGVQQHADKVQRALGEAIDDLKKVEINFQNL-SGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH 141
6 -57.200d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}  ali model 3D-neighbors follow..  29  1.AFTACEKQTIGKIAQVLAKSAYGAECLARLFVTHPGSKSYFEYK------DYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTE-FSPDTHCAVDKLLSAICQELSSRYR 140
13 -50.900d1hlba_ a.1.1.2 (A:) Hemoglobin, different isoforms {Caudina arenicola, also known as Molpadia arenicola [TaxId: 7698]}  ali model 3D-neighbors follow..  17  10GDLTLAQKKIVRKTWHQLMRNSFVTDVFIRIFAYDPSAQNKFPQMAGMSASQ-LRSSRQMQAHAIRVSSIMSEYVEELDSLPELLATL-ARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKH. 156
17 -49.300d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}  ali model 3D-neighbors follow..  13  1..LSADQISTVQASFDKVKGD--PVGILYAVFKADPSIMAKFTQFAGKD-LESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTF-VASHKPRGVTHDQLNNFRAGFVSYMKAHTD---FAGAEAAWGATLDTFFGMIFSKM. 136
20 -47.900d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}  ali model 3D-neighbors follow..  14  1.GLSAAQRQVVASTWKDIAGAGVGKECLSKFISAHPEMAAVFGFSG--------ASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQ 146
24 -46.300d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}  ali model 3D-neighbors follow..  21  9PTLTDGDKKAINKIWPKIYKEQYSLNILLRFLKCFPQAQASFPKFST--KKSNLEQDPEVKHQAVVIFNKVNEIINSMDNIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGA----------EFEKLFSIICILLRSAY. 146
25 -46.000d1h97a_ a.1.1.2 (A:) Trematode hemoglobin/myoglobin {Paramphistomum epiclitum [TaxId: 54403]}  ali model 3D-neighbors follow..  12  1.TLTKHEQDILLKELGPHHIVETGLGAYHALFTAHPQYISHFSRLEGHTIEN-VMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAAEKFLKHVFPMMAAEI..... 147
26 -45.800d3wfwa1 a.1.1.0 (A:1-133) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  15  1..MTREEIKMIQKSWLRVIDDEAGLLFYRRLFDVEPKVRPLF--------------KIDIEKQGRKLMDVLNWIVLNLQDIDAALDAALARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEEH. 133
27 -45.800d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  1.ECLVTESLKVKLQWASAERVAFGLELWRDIIDDHPEIKAPFSRV-----RGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFG---AWHDCVDQIIDGIK.... 140
28 -45.600d3ubca_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}  ali model 3D-neighbors follow..  16  1..IDQKEKELIKESWKRIEPNEIGLLFYANLFKEEPTVSVLF--------------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTA... 131
29 -45.200d1x9fc_ a.1.1.2 (C:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit III (globin C) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}  ali model 3D-neighbors follow..  15  5..CSEEDHRIVQKQWDILWRDGFGRLLLTKLAKDIPEVNDLFKRV-----DIEHAEGPKFSAHALRILNGLDLAINLLDDLDAALDHLAHQHEVREGVQKAHFKKFGEILATGLPQVLD----DYDALAWKSCLKGILTKISSRL. 149
30 -44.600d2zs0d_ a.1.1.0 (D:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  16  3..CSRGDAEVVISEWDQVSESAIGVAIFDVFFTSSGVSPSMFPGGGDS-------SSAEFLAQVSRVISGADIAINSLTNCDSLLSHLNAQHKAISGVTGAAVTHLSEAISSVVAQVLPSAHI----DAWGYCMAYIAAGIGAGL. 145
32 -43.500d3ozua1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}  ali model 3D-neighbors follow..  13  2..LTQKTKDIVKATAPVLAEYDIIKCFYQRMFEAHPELKNVFN-----------MAHQEQGQQQQALARAVYAYAENIEDPNSLMAVLIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLMGMES 138
34 -43.300d2zs0a_ a.1.1.0 (A:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}  ali model 3D-neighbors follow..  16  2..CNRLEQILVKTQWAQSNRAAFSRDLFSELFNIQGSSRALFSGV-----GVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLLAGQHASRNLDASNFAAMGQAVMSVVPTHLD----CFNQHAWGECYERIASGISG... 140
35 -43.300d1asha_ a.1.1.2 (A:) Ascaris hemoglobin, domain 1 {Pig roundworm (Ascaris suum) [TaxId: 6253]}  ali model 3D-neighbors follow..  15  1...ANKTRELCMKSLEHAEARQDGIDLYKHMFENYPPLRKYFKSREEYT-AEDVQNDPFFAKQGQKILLACHVLCATYDDRETFNAYTLLDRHARDHVHMPPETDFWKLFEEYLGK--KTTLDEPTKQAWHEIGREFAKEINK... 147
36 -42.500d3wctd_ a.1.1.0 (D:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}  ali model 3D-neighbors follow..  17  2..CSEADATIVIKQWNQISRWTMGNEIFSSLFKLKPESEVLFNNV-----NVANMSSGAFHAHTVRVLSGLDMGINYLNDLTSLTAHLAAQHVARTGLKAVYFDAMGKVLMTVLPS-LIDNFNPD---AWRNCLLPLKNAIAKGL. 146
37 -41.900d2wy4a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  12  1...TKEQIQIIKDCVPILQKEDLTNEFYKIMFNDYPEVKPMFN-----------MEKQISGEQPKALAMAILMAAKNIENLENMRSFVVAITHVNLGVKEEHYPIVGACLLKAIKNLLN--PDEATLKAWEVAYGKIAKFYIDIEK 134
39 -36.300d2xkia_ a.1.1.4 (A:) Nerve tissue mini-hemoglobin (neural globin) {Milky ribbon worm (Cerebratulus lacteus) [TaxId: 6221]}  ali model 3D-neighbors follow..  11  2............VNWAAV-----VDDFYQELFKAHPEYQNKFG-----VALGSLKGNAAYKTQAGKTVDYINAAIGGSADAAGL-----ASRHKGRNVGSAEFHNAKACLAKAC----SAHGAPDLGHAIDDILSHL......... 110
40 -35.700d1tu9a1 a.1.1.2 (A:2-130) Hypothetical protein PA3967 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  12  1.....NAADRVMQSYGRCASTGFFDDFYRHFLASSPQIRAKFA-------------TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRALGHSRAALDIRPELYDLWLDALLMAVAEHDRD-CDAETRDAWRDVMGRGIAVIKSYY. 129
41 -9.230d2ig3a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  12.......AKLMEIFYEKVRKD--------------KDLGPIFNNAIGTSDEE-------WKEHKAKIGNFWAGMLLGEGDYNG---QPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKNVILQRAQMIASHFQNMLYK... 123

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 5 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.