current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst GLSAAQRQVVASTWKDIAGADNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQSLast
1 -54.500[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  18  2.LDAQTIATVKATIPLLVE--TGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGD---QREALFNAIAAYASNIENLPALLPAVEKIAQKHTSFQ---IKPEQYNIVGTHLLATLDEMFN--PGQEVLDAWGKAYGVLANVFIHREAE 137
2 -19.200[C] KOG3378 Globins and related hemoproteins  ali follow..  13  258RITERQKHIFTETFPVIF--KEYKRNGLVLFAKYFSEFPHYKNIWPQFRLASNELANHCSVYMSGLKV............................................................................... 330
3 -11.200[R] COG2346 Truncated hemoglobins  ali follow..  12  24..........VTLYEAIGGDATVRALTRRFYELM-DTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHG-----PMLRRRHFVAP---IGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQEAD 149
4 -6.540[S] COG1295 Predicted membrane protein  ali follow..  16.......HTLKKTFTRTTERRLLGLGSEIAFNAMLSLFPAILAVLTAIGFFADSLQDTFRQLAAQLSQVAPE-EAMVLIREFAGREIANSRNSGLFSLSFVIAIWTASGAVSTAMTAFDQIHQIPQEKM.................. 136
5 -6.440[S] KOG4654 Uncharacterized conserved protein  ali follow..  19.........VVYIYELLCRGEDPSSESPEFWNEFFLLQPNFEALENEIGKNNEQLQLVKPNLNTLFQRCIEMLDTLHTLCSLFYGIFKKSNAEPTLNILNEKMDEWLKLLMQYCNRILLGDVPENARFMCLKLLQVLVTGTDNVNQN 171
6 -5.330[H] KOG2524 Cobyrinic acid a,c-diamide synthase  ali follow..  150.LLEERIRIMRASGRVLVDSKKCHNQAQRLIKLLLADFPDFRDV-SVYKGRECYMLKRAQILVAETWACFQRFDDIDSITMFADRVPQILWQLGCLSYSSD----FKKRLLKNELIAHNDPMEIEMRGCSIWAVEKILQNINRK... 302
7 -5.250[O] KOG4692 Predicted E3 ubiquitin ligase  ali follow..  5......LERMLRTLTTASNTGSLFSFVPEVYNTLPILLDAVMDFSHHDLKAQFEASDAECSVNAAAEFLGIHSADPRIVLASCKDS----QALGTLTCHKSGVRALERTSKRSQASLVRALLRPYENRAWGQSNWLLLRFW...... 138
8 -5.100[A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor  ali follow..  328.LNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALS--RICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAE 509
9 -4.970[P] COG3230 Heme oxygenase  ali follow..  13  46..TRGAHGDLDSFIMAAKPFESRENFGK-FVETQYLFHRDLDVFFSNVTLDGLLPDLKGRRRLAMIEQDLADLGTAEMPFDLPEAMGWLYVVEGSN---------LGAAFLLKDAAKLGAGAPEGRGLHWRTFTAALDEISLTVQEE 201
10 -4.910[U] COG5538 Preprotein translocase subunit Sec66  ali follow..  65.................................IFDENDAHDLYFQIKEMSENEKIHEKVLKAALLNRGAESVRRSLKLKELAPQINLLYKNGSIGEDYWKRFETEVKLIELEFKDTLQEA--ERLQPGWVQLFVMVCKEICFNQA. 175

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 6 1 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ma H, Xiong H, Liu T, Zhang L, Godzik A., Zhang Z. Aggregate formation and synaptic abnormality induced by DSCR1. J Neurochem. 2004 Mar;88(6):1485-96.