current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d3d1kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}, from SCOP207

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst VEWTDKERSIISDIFSHMDYDDIGPKALSRCLVVYPWTQRYFSGFGNLYNAEGIMSNANVAAHGIKVLHGLDRGMKNMDNIADAYTDLSTLHSEKLHVDPDNFKLLSDCITIVLAAKMGHAFTAETQGAFQKFLAAVVSALGKQYHLast
1 -40.200[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  2..LDAQTIATVKATIPLLVEPKLTAHFYDRMFTHNPELKEIFN-----------MSNQRNGDQREALFNAIAAYASNIENLPALLPAVIAQKHTSFQIKPEQYNIVGTHLLATLDEMFN--PGQEVLDAWGKAYGVLANVFIHREA 136
2 -26.300[C] KOG3378 Globins and related hemoproteins  ali follow..  15  257DRITERQKHIFTETFPVIFKERNGLVLFAKYFSEFPHYKNIWPQFRTLQDSA-LLASNELANHCSVYMSGLKV......................................................................... 330
3 -7.700[S] KOG4654 Uncharacterized conserved protein  ali follow..  14.RPKEKVVYIYELLCRGEDPSSESPEFWNEFFLLQPNFEALENEIGKLNNEQLQLVKPNLNTLFQRCIEMLDTLCNSLHTLCSLFYGIFKKSNAEPTLN-EKMDEWLKLLMQYCNRILLGDVPENARFMCLKLLQVLVTGTDN... 167
4 -6.820[L] KOG2994 Uracil DNA glycosylase  ali follow..  100.CYVPLSELLVEESWLKALPGEFHKPYAKSL-LIYPPQHLIFNALNTTPFDRVKT--GQDPYHGPGQAMGLSFSVPEGEKLPSSLLNIFKELHKDVGCSIPRHGNLGVLLLNAVLTVRSKQPNSHAKKGWEQFTDAVIQSISQQKE 265
5 -6.420[R] COG2346 Truncated hemoglobins  ali follow..  16...EATMSSETVTLYEAIGGDATVRALTRRFYETLPEAARCRAI-----------HPADLSGSEAKFYDYLTGYLGGPPVYVEK-HPMLRRRHFVAPIGPAERDEWLLCFRRAMDET---IENAKLREIIWAPVERLAFHMQNQ.. 146
6 -6.320[L] COG0692 Uracil DNA glycosylase  ali follow..  2............KNWTDVIGTEKAQPYFQHTLQIYPPQEDVFNAFKYTAFEDVKQDPYHGPNQAHGLAFSVKPEVASLLNIYKELTQDISGFQMPSNGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWERFTDKVIAVLNEHRE 154
7 -5.900[O] COG0576 Molecular chaperone GrpE (heat shock protein)  ali follow..  12  55................................EVENRYLRMQADFENVKKRHIADRDASQKYRSQSLAQDLLPALDSFEKALATTSDQEEVKQILKGM-----EMVYNQILVAFEPAVGEQFDPNFHQAVMQD-NEITAELQKGY. 175
8 -5.890[O] KOG3003 Molecular chaperone of the GrpE family  ali follow..  10  71................................ELMDKYKRSLADSENMRNRLNKQISDAKIFGIQSFCKDLLEVADTLGHATQAVPKDKLSGNADLKNLYEGLTMTRASLLQVFKRHINQKFDPNQHEALFQK-NTVVEVTKLGY. 196
9 -5.090[S] COG3644 Uncharacterized protein conserved in bacteria  ali follow..  10  75LGVVAREVTLLPRHWDWLAAQPGGASVALRKLVE-----------AARRAAEGPDRIRASRDAAYRFASAMAGDLPGFEEAMRSL............................................................. 148
10 -5.050[P] COG0598 Mg2+ and Co2+ transporters  ali follow..  169...NASATKKTRDLQSLIEQIGQKGDLLTVIRESLVSIGRLVAYHVAIEGSTPRKAAKESRQRIKLVQRDAASLGDHALFLSNKINFLLDATLGLINLEQNQFSVAAVVFLTLVASIYGMNFEVMPELTWRFGYPYALILMI.... 313

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 7 0 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.