current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: d1jl7a_ a.1.1.2 (A:) Glycera globin {Marine bloodworm (Glycera dibranchiata) [TaxId: 6350]}, from SCOP207

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value Template Links and tools%idFirst GLSAAQRQVVASTWKDIAGADNGAGVGKECLSKFISAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGNKHIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQSLast
1 3.000e-49UniRef50_A0A2K9UYR0 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR0_EXAPA  ali  27  22GLTAQQIELVRDTWKDVKQ--DLEGHGVTFYTRLFTEHPETQQLFTFRDKEDDRFKFQAKRVMEMVGAAVDGLDDVPSLAGVLKDLGARHVKW---NVKEEHYGPVGEALVFTLQTGLTEKFTTEVKEAWLAVYGIVADNMKAGARE 170
2 3.000e-49UniRef50_W6S202 Hemoglobin-like protein n=6 Tax=Firmicutes TaxID=1239 RepID=W6S202_9CLOT  ali  22  2.LDQKTIEIVKSTVPALK--EHGVEITKTFYKNMFENNPEVKRLFNMDRQASGE---QPKALAMTILAAAQNIDNLEVLLPAVKKIGERHC---DVQIKEEHYPIVGANLLVAIKEVLGDAATDEVIDAWGKAYEVIAKIFIDVEKE 139
3 3.000e-48UniRef50_A6DJX1 Flavohemoglobin n=2 Tax=Lentisphaera TaxID=256846 RepID=A6DJX1_9BACT  ali  17  2ALSQETIDIVKATAPVV--GENAEKITSRFYPIMFERYPMVKEFFNQSHQRDG---LQQKALAGAVVAYALNIDNLGALGGAVEGITERHASL---NVQPEHYPIVGECLLAAIAEVLGDAVTPEIANAWGEAYGFLAEILIGAEKA 140
4 3.000e-48UniRef50_Q9XDU3 Bacterial hemoglobin n=17 Tax=Firmicutes TaxID=1239 RepID=Q9XDU3_CLOPF  ali  18  2.LDQKTIDIIKSTVPVLK--SNGLEITKTFYKNMFEQNPEVKPLFNMNKQESEE---QPKALAMAILAVAQNIDNLEAIKPVVNRIGVIHCN---AKVQPEHYPIVGKHLLGAIKEVLGDGATEDIINAWAKTYGVIAEVFINNEKE 139
5 4.000e-48UniRef50_Q7WUM8 Flavohemoprotein n=33 Tax=Proteobacteria TaxID=1224 RepID=HMP_RHIME  ali  19  2.LTQKTKDIVKATAPVLAQ--HGYAIIQHFYKRMFQAHPELKNIFNMAHQERGE---QQQALARAVYAYAANIENPESLSAVLKDIAHKHASLG---VRPEQYPIVGEHLLASIKEVLGDAATDEIISAWAQAYGNLAD-ILAGMES 138
6 9.000e-48UniRef50_A0A166P7X2 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A166P7X2_9GAMM  ali  25  1.MTPEQIARVQASWQQVEGIAD--QAAALFYQRLFTQAPELEPLFK------GNMEEQGKKLMSMIGVAVKGLDRLDTIVPAVQKLGERHKDYG---VKPEDYDAVAQALLWTLAQGLGDAFDADTESAWTEAYTLLASTMIDAA.. 133
7 1.000e-47UniRef50_A5EFK6 Putative nitric oxide dioxygenase (NOD) n=135 Tax=Bacteria TaxID=2 RepID=A5EFK6_BRASB  ali  25  1.MTPSQITLVQESFAKVAPISD--QAAVLFYDRLFEVAPPVRAMFP------EDLTEQRKKLMGTLAVVVGGLSNLDTVLPAASALAKRHVNYGA---KPEHYPVVGAALLWTLEKGLGEAWTPEVAEAWTAAYGTLSGYMISEA.. 133
8 2.000e-47UniRef50_H0TDW5 Putative nitric oxide dioxygenase (NOD) flavohemoprotein n=102 Tax=root TaxID=1 RepID=H0TDW5_9BRAD  ali  26  1.MTPAQIALVQDSFAKVAPISDQAAI--IFYDRLFEVAPQVRALFP------DDLTEQRKKLMGTLAVVVNGLTNLPSILPAASALATRHVGYGA---KAEHYPVVGGALLWTLEKGLGDAWTPEVAEAWSAAYGTLSSYMIAEA.. 133
9 2.000e-47UniRef50_A0A1Z9E261 Hemin receptor n=1 Tax=Gammaproteobacteria bacterium TMED119 TaxID=1986671 RepID=A0A1Z9E261_9GAMM  ali  24  1.MTPEQITLVQESWAKVVPIK--ETAAELFYGRLFAEYPEVKPYFK------GDMTEQGKLLMQMISTAVNGLENLDALLEPVKALGSRHKDYG---VKQADYDKVGASLLWTLEQGLKEDFTEEVKAAWTETYTIVADVMIGGAE. 134
10 3.000e-47UniRef50_UPI0003F6041F NO-inducible flavohemoprotein n=1 Tax=Bacillus TaxID=55087 RepID=UPI0003F6041F  ali  23  2.LSEKTMQIVKSTAPVLK--EKGTEITSCFYKRMFNAHPELKNIFNMSRQQTG---GQPKALAYTVLQAAENIDRLEALLPVVKQIGHKHKSL---DVKPEHYPIVGQHLLEAIEIVLGDAATEEILQAWAEAYEEIARVFIEIEKQ 139
11 3.000e-47UniRef50_A0A2G5WM90 Flavohemoprotein n=29 Tax=Bacillales TaxID=1385 RepID=A0A2G5WM90_9BACL  ali  23  2.LDQKTIDIIKSTVPVLEQ--HGKTITTVFYKNMFEAHPELLDIFNHANQSQG---RQQTALANTVYAAAQHIDNLAAIIPAVVQIAHKHVSLG---ILPEHYPIVGEHLLGAIKEVLGDAATPEIVDAWAAAYGVIADAFIGVEAE 139
12 4.000e-47UniRef50_Q0VR92 Oxidoreductase n=6 Tax=Bacteria TaxID=2 RepID=Q0VR92_ALCBS  ali  23  1.MTPVQIALVQNSWDKVDAISD--QAASLFYDRLFTNDPALKPLFK------GNMEEQGKKLMTMIGVAVRGLDKLDTIVPAVQKLGARHKDYG---VKPADYDTVAQALLWTLGQGLGDAFDSDTEAAWVAAYTILATTMIAAAD. 134
13 5.000e-47UniRef50_M5P8Y4 Flavohemoglobin Hmp n=1 Tax=Bacillus sonorensis L12 TaxID=1274524 RepID=M5P8Y4_9BACI  ali  23  2.LSEKTMQIVKSTAPVLK--ERGTEITSCFYERMFKAHPELKNIFNMSRQQTG---GQPKALAYTVLQAAENIDRLEALLPVVKQIGHKHKSL---QVKPEHYPIVGKHLLEAIEAVLGEAATPDILQAWAEAYEEIARVFIDIEKQ 139
14 5.000e-47UniRef50_A0A2A5GVQ4 Flavohemoprotein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A2A5GVQ4_9PROT  ali  20  2.LSQQTIDIVKSTAPIL--QEHGETLTKHFYKRMFSHNPEVLPFFNPANQTEG---TQQRALANAICAYAANIDNLEVLGSAVELIAQKHASL---QIKPEHYPIVGENLLESIREVLGEAANDDIINAWGEAYGFLADILIGRE.. 137
15 5.000e-47UniRef50_A0A2W8V006 Nitric oxide dioxygenase n=1 Tax=Burkholderia multivorans TaxID=87883 RepID=A0A2W8V006_9BURK  ali  23  2.LTQQTKDIVKATAPVLAQ--HGYDIIQCFYRRLFDAHPELKNVFNMTHKEQGQ---QQQALARAVYAYAENIEDPGSLAAVLKNIANKHASLG---VRPEHYPIVGEHLLGAIKETLGDAATDEIISAWAQAYGNLAD-LLAGMES 138
16 5.000e-47UniRef50_A0A1Y0YLF9 Nitric oxide dioxygenase n=22 Tax=Bacillus TaxID=55087 RepID=A0A1Y0YLF9_BACLI  ali  24  2.LSEKTMQIVKSTAPVLK--EKGTEITTCFYKRMFDAHPELKNIFNMSRQQTG---GQPKALAFTVLQAAENIDRLEDLLPVVKQIGHKHKSL---HVKPEHYPIVGQHLLEAIEIVLGEAATEDILQAWAEAYEEIARVFIEVEKQ 139
17 9.000e-47UniRef50_UPI000DA1778E NO-inducible flavohemoprotein n=3 Tax=Salinicola TaxID=404432 RepID=UPI000DA1778E  ali  20  3..TAAQIEIVKRTIPVLRQ--HGETLTRHFYARLFEHAPDVRRYFNPAHQRSG---GQQRALAGAILAYAQHIDDPAALSDAIEVIAQKHASL---TIQPEHYPIVGEHLLASIREVLGDAATADVLDAWAAAYDELAGVFIERER. 138
18 9.000e-47UniRef50_A0A1Q9AL98 Hemin receptor n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q9AL98_9RHIZ  ali  28  1.MTPTDIDLVQSSFAKVVPIK--EAAAELFYGRLFEIAPEVKPL------SKGDMKEQGRKLMMTLGVVVNGLKDLPSIVPAAEALAVKHNGYG---VKPEHYQVVGDALLWTLEQGLGPDFTPQTKSAWATAYGTLSGVMIAA... 132
19 9.000e-47UniRef50_UPI000248E5F7 globin n=2 Tax=Aquimarina TaxID=290174 RepID=UPI000248E5F7  ali  24  1.MESKTIELVQGTFKQVAPIAD--QAAEIFYSKLFEKDPSLKPMFK------GDMKQQGAKLMAMIGTAVNGLNNLEALVPAVQNLGKGHAGYG---VEDKHYDTVGAALLETLDVGLGDAFTPEVKEAWTEVYTVLATTMKDAANS 135
20 1.000e-46UniRef50_A0A1R4KM78 Flavohemoprotein n=64 Tax=Bacteroidetes TaxID=976 RepID=A0A1R4KM78_9SPHI  ali  18  4NMTTEQKQMVKATVPVLK--EHGVLLTTHFYKRMFEHNPELKHVFNMGNQQNSK---QQTALAHAVLAYAEHIEDPSVLLPVVNNIGHKHTSL---DIRPEHYAIVGRHLIASIGEVLGDAATPELIDAWTTAYGQLADLM...... 136
21 1.000e-46UniRef50_UPI0009957A22 NO-inducible flavohemoprotein n=1 Tax=Bacillus patagoniensis TaxID=228576 RepID=UPI0009957A22  ali  22  7.LSEQQVELIKSSVPVLA--EHGLTITKRFYADLFEAHPELLNLFNHANQKQDK---QQQALANTLYAAAANIENLEELLPVVKQIAHKHRSL---QVKPEHYPIVGEHLLEAIKKVLGSSATNELLDAWANAYDIIADVFISVEAE 144
22 1.000e-46UniRef50_Q07S70 Globin n=6 Tax=cellular organisms TaxID=131567 RepID=Q07S70_RHOP5  ali  29  1.MTPDQIALVQQSFTKVAPIADVA--AGLFYGKLFDIAPEVRALFK------GDIAEQGKKLMGTLGVVVSGLTDLDAILPAASRLARHHVSYG---VKPSHYAPVGAALLWTLEKGLGDEWTPDLAEAWTAAYGTLSGYMIE.... 131
23 2.000e-46UniRef50_A0A163CMC1 Flavohemoprotein n=8 Tax=Betaproteobacteria TaxID=28216 RepID=A0A163CMC1_9NEIS  ali  21  2.LSEQTRALVKATVPVLK--EHGVTLTSHFYQRMFRHNPELKNVFNQGHQASGQ---QQQALAGAVLGYAEHIDDPSVLAPVVMRIAHKHASLG---IRAEHYPIVGGHLLASIREVLGDAASDELIAAWAEAYGQLADILIAAE.. 137
24 2.000e-46UniRef50_A0A0L1HFZ0 Flavohemoprotein n=26 Tax=leotiomyceta TaxID=716546 RepID=A0A0L1HFZ0_9PLEO  ali  20  3GLTPSQVQIIKATVPVLA--EHGATITTKFYHDLLEAHPQLKNVFNNTHQATG---HQAKALAGSLYAYAANIDDLGKLSPALELICHKHASL---FIRPDQHAIVGKHLLETMKTVLGDAATPEILEAWGAAYWQLANVMIGKEDQ 141
25 2.000e-46UniRef50_A0A0J5PJK4 Flavohemoprotein, putative n=6 Tax=Aspergillaceae TaxID=1131492 RepID=A0A0J5PJK4_ASPFM  ali  21  102GLTTQQKEIVKSTIPAL--QEHGVTITTLFYKRLLEAHPELKNIFNTAHQATGE---QPAALAHAVWAYASNIDQPEALSTAVSRIGHKHASLG---VLPEHYPIVGQHLLVSIKDVLGPAANEQVLNAWAAAYQELADMFINFEDE 240
26 2.000e-46UniRef50_A0A2S5LYU6 Flavohemoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A2S5LYU6_9PROT  ali  21  2.LSDQTIAIVKSTAPIL--QEHGETLTKHFYKRMFSHNPEVAPYFNPANQAAG---LQQKALAGAICAYAANIDNLEMLGGAVELIAQKHVSL---QIKPEHYPIVGENLLASIREILGEGATDEVVNAWAEAYGFLADIMI..... 134
27 3.000e-46UniRef50_A0A1S2DE36 Nitric oxide dioxygenase n=3 Tax=Salinicola TaxID=404432 RepID=A0A1S2DE36_9GAMM  ali  20  3..TPAQIDVIKQTVPVLQQ--HGEALTRHFYARMFEHNPEVKRYFNPAHQRSG---GQQRALAGAILAYAQHIEDPSALASAIEVIAQKHTSL---TIQPEHYPIVGENLLASIKEVLGDAATDDILDAWAAAYGELAQVFIDREQA 139
28 3.000e-46UniRef50_A0A150QD55 Hemoglobin (Fragment) n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A150QD55_SORCE  ali  23  73..SPRTIELVQSSWAKVMPISDAA--SALFYERLFTIDPSVRPLFKN------DIAEQKRKLMQMLSVAVDGLSNLPKLVPVLQSLGARHQGY---MVAEHHYDLVGEALLWTLREGLGEAFTSDVEAAWKEVYGVIADVMKK.... 202
29 4.000e-46UniRef50_A0A0N1C593 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A0N1C593_9BRAD  ali  23  1.MTPDQIALVQQSFSKVAPIS--EQAASLFYGRLFEIAPEVKPLF-----AKADIREQGKKLMGTLAVVVGGLTDLPSILPAASRLAKHHVGYG---VTAAHYAPVGAALLWTLEQGLGDAWTPELKEAWTGAYTTLSSYMIGEA.. 134
30 4.000e-46UniRef50_UPI000CF3C16C NO-inducible flavohemoprotein n=1 Tax=Deinococcus sp. NW-56 TaxID=2080419 RepID=UPI000CF3C16C  ali  20  2.LTPEQTAIIKATVPALEA--HGETITRTFYASMFAAHPELLNIFNPANQKTG---RQARSLAASVLAYAAHIDHPERLGGMVGRIAHKHVSL---EVLPEHYPIVGEHLLGAIASVLGDAATPEILDAWAAAYGQLAKIMI..... 134
31 4.000e-46UniRef50_A0A1W7AAF8 Flavohemoprotein n=37 Tax=Bacteria TaxID=2 RepID=A0A1W7AAF8_9STAP  ali  19  2.LTEETKNIVKATIPVLE--EHGTEITSAFYKHMFEEHPELLNVFNKTNQ---KLGRQQTALAQTVIAAAKHIDHLEAIIPNVNQIAHKHRAL---EIKPEHYPIVGENLIWAIQHVLGDAATPEIVDAWSKTYGVIADVFIQ-MEA 138
32 5.000e-46UniRef50_A0A2D0NFV7 Hemin receptor n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NFV7_9BACT  ali  21  1.MDPQTVNLVQTSFQKVIPIADLAM--KIFYTKLFEIDPSLQNLFPTGE---EQMGKQRNKLRDMLVVAVNSLSKPEVLIPALQNLGRRHVGYG---VAAEHYNTVGQALIDTLAAGLGDDFTPEVKTAWGEVYGLIATTMIEA... 135
33 5.000e-46UniRef50_A0A1E5TA13 Hemin receptor n=4 Tax=Bacteria TaxID=2 RepID=A0A1E5TA13_9FLAO  ali  23  1.MESKTIALVQESFEKVKPI--APAAAEIFYNKLFELDPQLKPLFPNSE---GEMKEQRNKLMSMLGAAVAGLSNLDALIPILKNLGKRHVDY---KVEAFHYVTVGEALIGALEVGLGDDFTQDVKEAWANVYGVISNVMIEGA.. 136
34 6.000e-46UniRef50_A0A2N0QM05 Globin-like protein (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2N0QM05_9GLOM  ali  25  1.LSQQTIDVIKSTVPVLEQ--HGVTITKTFYSNMLNAHPELLNYFNRANQQKG---RQQTALANTVLAAAKYIDNLEPIVPVVMQIAHKHRGLG---ILPEHYPIVGENLLRAIKEVLGDAATDEIIDAWANAYGVIAEIFISVEED 138
35 6.000e-46UniRef50_A0A239M371 Flavohemoprotein n=25 Tax=Bacteroidetes TaxID=976 RepID=A0A239M371_9BACT  ali  19  1.MTTAQKELIKATVPILR--EHGVALTTHFYSRMFKHNPELKNVFNMGNQGNGK---QQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVSL---DIRPEHYAIVGQHLLASIKEVLGEGATDELIAAWAAAYQQLADLMTGLEKS 138
36 6.000e-46UniRef50_A0A1I1MV56 Flavohemoprotein n=1 Tax=Cupriavidus sp. OV038 TaxID=1855313 RepID=A0A1I1MV56_9BURK  ali  21  2.LTQKTKDIVKATAPVLA--EHGYDIIKCFYTRMFQAHPELKNIFNMAHQERGQ---QQQALARAVYAYAENIEDPSSLMAVLTNIANKHASLG---VRPEQYPIVGEHLLAAIKEVLGSAATDDIISAWAQAYGNLADVLM-GMES 138
37 6.000e-46UniRef50_A0A1H8YFV1 Nitric oxide dioxygenase n=18 Tax=Bacteria TaxID=2 RepID=A0A1H8YFV1_9PROT  ali  25  1.MTPHQIKLVQTSFAQVAPI--AATAADLFYGRLFEIAPHVRAMFP------DDLREQKKKLMAMLGTAVAGLSHLETLVPVVQALGRRHAGYG---VKAPHYASVGSALLWTLEKGLGEAFTPEVRDAWATTYIVLSTTMMNAANE 135
38 6.000e-46UniRef50_A0A1X9YXZ9 Flavohemoprotein n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A1X9YXZ9_9BACT  ali  18  1.MTNEQKELIKATVPVLR--KHGVALTTHFYSRMFTHNPELKNVFNMGNQGNGK---QQLSLALAVLAYAEHIEDPSVLVSAVTKIGHKHVSL---DIRPEHYAIVGKHLLASIGEVLGEGATDELIEAWAVAYQQLADLMTGLEKS 138
39 6.000e-46UniRef50_X2GRE8 Dihydropteridine reductase n=14 Tax=Bacillales TaxID=1385 RepID=X2GRE8_9BACI  ali  19  2.LDQHTINVIKSTVPVLEV--HGVAITKTFYHNLFKDNPSLLNIFNHTNQTKG---RQQGALANTVYAAAQHIDNLEPIVPVVVQIAHKHVSLG---VLPEHYPIVGQYLLAAIKEVLGDAATDEIIEAWGKAYGVIADIFISVEED 139
40 7.000e-46UniRef50_W7E6F8 Flavohemoprotein n=11 Tax=Bacteria TaxID=2 RepID=W7E6F8_9PROT  ali  18  2.LTENQKSIIKATVPVLA--EHGVALTSHFYERMFAQNPELKQVFNRGHQEAGK---QQHALAGAVLAYAQNIDNPTVLQGALVHIANKHVSLG---IRAEHYPIVGKHLLASIKEVLGEGATDELIDAWGKAYEQLANLLIE.... 135
41 8.000e-46UniRef50_A0A1Z5H8E0 Nitric oxide dioxygenase n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z5H8E0_9GAMM  ali  24  39.LSSEQINLVRESWKRVLPIK--EQAAELFYQRLFELDPDVKSLFK------GRLDFQGDKLMTTLDVVVNSLDDLHEVEGMLQAMGRRHIIYG---VEAAHYETVGAALLWVLAQGLGEHFTEEVEEAWVTAYGVIATTMKEAA.. 171
42 9.000e-46UniRef50_C9SVM3 Bacterial hemoglobin n=1 Tax=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) TaxID=526221 RepID=C9SVM3_VERA1  ali  21  2AMTEAQTAIVKSTAPILK--EHGLTITTVFYKSMLGAHPELHNVFNLSNQRSG---AQQKSLANAVLAYATHIDELQKLGPAVERIAQKHVSLG---ITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFIKRE.. 138
43 1.000e-45UniRef50_K9WVS1 Family 3 adenylate cyclase n=2 Tax=Cylindrospermum TaxID=56106 RepID=K9WVS1_9NOST  ali  21  724.LVPSQVDLVQSSFAKVKPIADKA--AEIFYNRLFELAPSFRPLFK------GDMKQQERKLMNTLALAVEGLRQPDQIIPAVQKLGRNHAGYG---VKAEYYDIVGEALLWTLAQGLGEDFTTPVRKAWEEAYTFLSEIMKEAAAE 858
44 1.000e-45UniRef50_A0A2N5KSE6 Hemoglobin (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5KSE6_9ACTN  ali  24  6..TVRQKELVQSTWKRVIPISKTAP--TLFYARLFELDPQLRALFPAGERS---MKAQHLKLMQMIHICVRGLDQLDRIVPAVQNLGRRHVGYGARN---GDYDTVGVALLWTLEQGLGDAFDDEVKEAWASVYGVLAATMIGAANE 142
45 1.000e-45UniRef50_A0A2C9D3E3 Nitric oxide dioxygenase n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A2C9D3E3_9RHIZ  ali  21  1.MTPEQVKLVQESFQKVAPIADAAA--DIFYNRLFEVAPEVRSMFPA------DMSDQKGKLMKTLGVAVQNLHQVQTILPVVQELGAKHVAYG---VKPEHYDTVGSTLLYTLEKGLGDAWTPELKDAWTETYVTVATVMKDAA.. 133
46 1.000e-45UniRef50_A0A2N1IDL0 Methyl-accepting chemotaxis protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N1IDL0_9GAMM  ali  23  1.MTPNQISLVQTSWQKVLPI--APQAAEIFYTTLFEMDPSLKALFPN------DIAEQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHLKYGA---EPEHYDTVGAALLKTLAQGLGDDFTAPTKKAWTAVYQTLASTMIAAANE 135
47 1.000e-45UniRef50_A0A0H2LWB1 Flavohemoprotein n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0H2LWB1_VARPD  ali  16  1.MTPQTIAIVKATVPAL--QAHGEAITSHFYRIMFETHPEVKAFFNEAHQAAGS---QARALAGAVLAYATHIDRLDEIAGALPRIIQKHAALG---VLPEHYPVVGGCLLQAIKDVLGDAATDEIIAAWGEAYQSLAALLIAAEEE 138
48 1.000e-45UniRef50_W7B9N7 Flavohemoprotein n=1 Tax=Listeria grandensis FSL F6-0971 TaxID=1265819 RepID=W7B9N7_9LIST  ali  24  5..TEEQKQIVKSTAPILK--EHGKEITAIFYKKMFAAHPELLNYFNMTNQ---EIGTQPLALANTVYLAAENIEQLEILLPQVKTIAHKHRSL---TIKAEHYPIVGEYLLKGIAEYLGDAATPEILDAWGAAYGIIADIFIEVEQE 141
49 2.000e-45UniRef50_UPI0009DEF53C hypothetical protein n=2 Tax=Kitasatospora TaxID=2063 RepID=UPI0009DEF53C  ali  25  156........LIKSSFAVVEP--HGSEVTAYFYAHLFEHNPDVRKLF------AEHMNDQQDRLWAAIGTLVNRLEDTDTVVNVLQGLGRRHIGYGAL---PEHFPAVGGSLLASLAHFAGDAWTPEIEAAWTALYGVITDVMSAAM.. 281
50 2.000e-45UniRef50_A0A2A5SZ43 Putative bacterial hemoglobin n=7 Tax=Bacteria TaxID=2 RepID=A0A2A5SZ43_9BACT  ali  17  2SLTPHQITLISQSFYKVEPIS--EKITEIFYKTLFAYEPTVKSLFK------GDMQQQGRKLMVMLHTVVNSLNRLDNLVPVLQDLAKRHVDYG---VKKTHYTPVGNALIHTLQIGLGDDFTPEVKAAWIAILDIIADTMKAEMDS 137
51 2.000e-45UniRef50_UPI0004949DD7 hemin receptor n=1 Tax=Bosea sp. 117 TaxID=1125973 RepID=UPI0004949DD7  ali  18  1.MTPDQIVLLRRSIDGLRP--HSEQAAALFYGRLFEMLPEVRPLF------TEDMVEQGRKLMRTLVAVMNGIDDMRSLRPAVERLGQRHLQYG---VRQEHYEPVGVALIWALEQGLGDAFTPDTRSAWLKAYDVLTQIMLDAA.. 133
52 2.000e-45UniRef50_A0A257CVZ8 Hemin receptor n=19 Tax=Bacteria TaxID=2 RepID=A0A257CVZ8_9BURK  ali  24  1.MNANQIALVQSSFEDVRPIAEVA--AELFYGRLFETDPMLKPMFK------GDMANQGRMLMSVLSAAVKGLSDLDALAPVLRNLGARHHNYG---VQEEHYVTVGSTLLWTLSQGLGDKFTPEVRAAWTDAYGLIADVMQFGA.. 133
53 2.000e-45UniRef50_A0A239ZQU0 Putative flavohemoprotein n=1 Tax=Staphylococcus stepanovicii TaxID=643214 RepID=A0A239ZQU0_9STAP  ali  22  2.LSEKTREIVKETVPVLEQY--GTEITKVFYERMFEAHPELLNIFNKSNQKQGK---QQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRAL---QVKEEHYPIVGEFLLKAIKEVLGDAATDEIMNAWEEAYGEIASVFIAMEKE 139
54 3.000e-45UniRef50_A0A1Z3HMF2 Bacterial hemoglobin n=7 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z3HMF2_9CYAN  ali  24  12..TALQIELLEQSFAKVKPQAN--EFVASFYDNLFTDYPAAKPLF-----AHTNMAEQGQKLLMSLVFVIENLRQPGELTAALQGLGARHVKYGAL---PEHYPLVGNSLLKTFEQYLGADWTPDTKAAWVDAYGLITEVMLEGAD. 145
55 3.000e-45UniRef50_A0A1M3FWD1 Hemoglobin n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3FWD1_9SPHI  ali  22  1.MTQQEITIIRRTWKIFRSI-NPDIVGDAFYSKLFADAPAVRKMFPA------EMNAQYKKLVDMLSGIVANLDDISVLSGDIAAMARRHVEYG---VRPGHYKVVGNALLWTLQQGLGTDWNPAVESAWRKCYQQLAEAMIAA... 133
56 4.000e-45UniRef50_S7X5W1 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Cytophagales TaxID=768507 RepID=S7X5W  ali  16  1.MNNSQREIITATVPILR--EHGVALTTHFYKRMFSHHPDLKNIFNMGNQKTGK---QQQALAMAVLAYAEHIANPGVLLPELHRIGHKHVSL---EIRPEHYPIVGNHLIASIKEVLGEAASLEILEAWEIAYNQLADLMM..... 133
57 4.000e-45UniRef50_S3D2U5 Globin-like protein n=1 Tax=Glarea lozoyensis (strain ATCC 20868 / MF5171) TaxID=1116229 RepID=S3D2U5_GLAL2  ali  22  4.LTKSQIQTIKATVPVLAQ--HGETITTKFYADLLVAHPELKNVFNSTHQATG---RQARALGASLHAYASNIDDLGRLSPALELICHKHASL---YIQPESYDVVGYHLLKAMKEVLGDAATPEILDAWETAYWQLANIMMSKEKD 141
58 4.000e-45UniRef50_A0A090T2N7 Flavohemoprotein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A090T2N7_9VIBR  ali  17  2.LSNQHIEIIKSTIPLLESA--GPALTQHFYQRMFAHNPELKDIFNMTHQKSG---RQSVALFEAVAAYAKNIENLAALSAAVERIAHKHTSF---HIKAEHYQIVGHHLIETLRELAPEAFTPAVEEAWTEAYLFLAQIFIDREEE 139
59 5.000e-45UniRef50_A0A261QJA7 Flavohemoprotein n=9 Tax=root TaxID=1 RepID=A0A261QJA7_9BACI  ali  21  2.LSEKTIEIVKATAPVLEV--KGKEITTYFYKTMFADHPELLNIFNHANQEKG---RQQTALANTVYAAAKYIDQLEVLVPAVKQIGHKHRSL---AVKPEHYPIVGEYLLKAIKEVLGEAATDDIINAWAEAYGVIAKVFIDVEAE 139
60 6.000e-45UniRef50_M7CUM7 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=M7CUM7_9ALTE  ali  17  2.LSPESRSIIDATLPAVEA--HANDITDVFYPLMFERYPEVKAYFNQTHQAEG---TQRRALANAVVAYARNLDRLEALGDAVSLIVNKHVSL---NIQPEHYPIVGECLLAAVKQVLGDAATEEVLAAWGEAYQQLADILISAEE. 138
61 7.000e-45UniRef50_A0A086D0Q4 Uncharacterized protein n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A086D0Q4_9GAMM  ali  18  2.LSPDQIATVKQTIPVLEA--HGDTLTRHFYTRMFAHNPEVKPYFNPAHQREG---AQQRALAGAILAYARHIDDTAALAPAVEVIAHKHASL---TIRPEHYPIVGENLIASIQEVLGDAATPEIVDAWKAAYAQLAAVFIGREHE 139
62 7.000e-45UniRef50_A0A033V6X9 Uncharacterized protein n=22 Tax=cellular organisms TaxID=131567 RepID=A0A033V6X9_STAAU  ali  22  2.LSEQTKEIVKQTVPVLEQYGN--EITKVFYQRMFEAHPELLNIFNKSNQKQGK---QQTALAQTVLAAAKHIDHLEAIVPNVNQIAHKHRAL---QVKEEHYPIVGEFLLKAIKEVLGDAATDDIMNAWEEAYGEIAGVFIQMEKA 139
63 7.000e-45UniRef50_UPI000361A298 NO-inducible flavohemoprotein n=1 Tax=Algicola sagamiensis TaxID=163869 RepID=UPI000361A298  ali  19  2.LSQQTMTIIQSTAPVLA--EHGVAITDRFYHLLFSAHPALKHIFNMSNQSEG---TQKKALAQAVYSYAQHIDRLADLLPLVERIAHKHASLG---ILPEHYPIVGKYLIEAIQDVLQDAFTDEIKAAWVEGYQMLADILIAREEQ 139
64 8.000e-45UniRef50_UPI000557B650 hypothetical protein n=1 Tax=Dongia sp. URHE0060 TaxID=1380391 RepID=UPI000557B650  ali  24  1.MTPRQIEIVKLSFARIMPFKD--QAAELFYCRLFELDPSLRLMFRS------DMNEQKQKLMVAIALVVTNLDRMDNFLPAVRELGQRHKTYG---VRNRQYEIVGAALIWTLEIGLGTGWNAELEEAWKNAYGCVAAAMIEGAES 135
65 8.000e-45UniRef50_E1X5F5 Putative flavohemoprotein n=3 Tax=Halobacteriovorax marinus TaxID=97084 RepID=E1X5F5_HALMS  ali  17  17.LESKTIEIIKSTAPILE--EHGVLLTKHFYKKLFEKNPEVMPYFNRAHQ---EMGTQQEALAGAICAYAKNIDNLSALSGAVSLIANKHSSL---KIKPEHYPIVGVNLLESIKEVLGDGATDDIISAWKKAYFFLADILIEAEKN 154
66 1.000e-44UniRef50_A0A078M590 Flavohemoprotein n=9 Tax=Bacillaceae TaxID=186817 RepID=A0A078M590_9BACI  ali  17  2.LQQQTMDIIKATAPVLEV--HGVTITKTFYQNMFDNHPELLNIFNHTNQARG---RQQTALANTVYAAAVHIENLEAILPVVVQIAHKHVSLG---VLPAHYPIVGKYLLAAIKEVLGDAATPEILQAWEQAYGVIADIFIQVEED 139
67 1.000e-44UniRef50_A0A2L0EJF9 Uncharacterized protein n=1 Tax=Sorangium cellulosum TaxID=56 RepID=A0A2L0EJF9_SORCE  ali  24  74.LSPRTIELVQWSWAKVMPISDAA--AALFYERLFTLDPSVRPLFKN------DIAEQKKKLMQTLAVAVDGLNNLGKLVPVLQSLGVRHHGY---MVAEHHYDVVGEALLWTLREGLGDAFSSDIETAWKEVYGVIADVMKK.... 204
68 2.000e-44UniRef50_A0A258BJQ5 Flavohemoprotein n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A258BJQ5_9CAUL  ali  19  6.LSPETIAIVKATASVL--NEHGETLTRHFYQRMFRENPEVLPLFNPSNQHSG---GQQKALAGAICAYAANIDNLEVLGGAVELIAQKHASL---LIAPEHYPIVGANLLAAIREVLGEAATDAVIGAWAEAYGFLAEILMGRERQ 143
69 2.000e-44UniRef50_A0A0R3NBJ6 Hemin receptor n=4 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A0R3NBJ6_9BRAD  ali  21  1.MSPETKELLKSTWAKVVPISDVA--AGLFYERLFTLDPSLQRLFK-----NADMKEQRRKLVQALSAVINSVDDLPSLVPTLEILGRNHIRYG---VEDRHYDTVGAALLWTLEQGLKEAWTPAAKSAWVVAYSTVSGVMRDVA.. 134
70 2.000e-44UniRef50_W7ATG7 Flavohemoprotein n=3 Tax=Listeria TaxID=1637 RepID=W7ATG7_9LIST  ali  22  2.LDEKTREIVKSTIPFL--QDKGTEITGIFYQNMFKAHPELLNIFNQNNQREG---TQSKALANTVLAAAMNIDDLSVLKPHVIQIGYKHRAL---QVKPEHYPIVGHHLIEAIGIVLGDAATDEIIDAWTAAYGEIAQVFIDAEKE 139
71 3.000e-44UniRef50_A0A094H7R8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4520 (FW-2644) TaxID=1420915 RepID=A0A094H7R8_9PEZI  ali  21  276.MTRQQQDIVKSTAPVLA--EHGIAITTHFYKRMLEARPELKNIFNIAHQATG---AQPAALAHAIWAYADNIDNLGALTSAVSRIGHKHASLG---VTPDQYAIVGEHLLASIKEVLGDAVNEPVLDAWAAAYEQLAEIFIRFEKD 413
72 3.000e-44UniRef50_A0A1G7TWS7 Nitric oxide dioxygenase n=4 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1G7TWS7_9FLAO  ali  18  1.MTSKQKRSIKDTIPTLK--TNGIDLTKHFYKRMFFHNPELKNVFNMGNQANGK---QQNALAGAVLAYAEHIENPGILIGTLETIGNKHVSL---NITPEQYDIVGTHLLASIKEVLADKATDDIIEAWTQAYNELAAIMISIEE. 137
73 4.000e-44UniRef50_UPI00078047DE NO-inducible flavohemoprotein n=1 Tax=Pseudoalteromonas arabiensis TaxID=874454 RepID=UPI00078047DE  ali  19  2.LSEKTIEIVKSTVPLLAEA--GPQVTEYFYDRMFSYNPELKNIFNMSHQQSG---HQQFALFNALAAYAANIDNLAVLKDALARINHKHTSY---HILPEHYPIVGGHLIATLKELLPEQFTPEVEYAWREAYALLADVCITEE.. 137
74 4.000e-44UniRef50_A0A1F7ZJE5 Flavohemoprotein n=1 Tax=Aspergillus bombycis TaxID=109264 RepID=A0A1F7ZJE5_9EURO  ali  23  262.LTPQQIQIVKSTIPALEA--HGVAITTLFYQRLLQQHPELKNIFNTAHQATGE---QPAALAHSVWAYATNIEHPEALKPAISRIGHKHASLG---ITADQYPAVGEGLLAAIKEVLGDAVDDQVLDAWRAAYGELAGYFID.... 395
75 4.000e-44UniRef50_K9Y083 Nitric oxide dioxygenase n=19 Tax=Cyanobacteria TaxID=1117 RepID=K9Y083_STAC7  ali  23  115GVSQKTIDIVKSTAPVIKQ--HGKTITTRMYEIMFDTHPEVKSQFDMAAQANG---TQHAKLATAVYSYATHIDDLESLKAMVDKIAHRHV---ATHVLPEQYPIVGECLLKAIKDVLGDAATEEVMTAWAEAYQALAGVFINREQQ 253
76 4.000e-44UniRef50_A0A1M7FB72 Nitric oxide dioxygenase n=4 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A1M7FB72_9BURK  ali  21  1.MTPHDIHLIRHSFNLVQP--HAADTAQRFYENLFAADPGLRELF------RTDIRHQGERLMTMLAAAIRVLDDPFTLHAALRLLGRRHAGYG---VHAEHYATVGAALIRTLREGLGDAFTPEVHDAWVAMYGIVSRTMIEAARE 135
77 5.000e-44UniRef50_Q2U124 Uncharacterized protein n=154 Tax=cellular organisms TaxID=131567 RepID=Q2U124_ASPOR  ali  23  3.LSPEQIQLIKATVPVLQQ--HGTTITTVFYNNMLTAHPELNAVFNNANKVNG---HQPRALAGALFAYASHIDDLGALGPAVELICNKHASL---YIQPEQYQIVGKFLLEAMGEVLGDALTPEILDAWATAYWQLADLMIGREAE 140
78 5.000e-44UniRef50_L0G369 Hemoglobin-like flavoprotein n=1 Tax=Echinicola vietnamensis (strain DSM 17526 / LMG 23754 / KMM 6221) TaxID=926556 RepID=L0G369_ECHV  ali  19  3..SKSTIEIVKSTAPVLK--EYGEQITKVFYKKLFETHPDLRNLFNMTNQVKG---TQPKVLANAIIQYATYIETPEVLLQAVNSIAHKHSSL---SITPEMYPIVGETLLWAIKEVLGDAATPDIIGAWAEAYGELAEIFIAKEDS 139
79 6.000e-44UniRef50_UPI000837A761 NO-inducible flavohemoprotein n=1 Tax=Alteromonadaceae bacterium XY-R5 TaxID=1737567 RepID=UPI000837A761  ali  21  6.LDDRTRELVKATAPIL--LEHGETITRCFYNRMLSKHPELKRYFNQTHQQSG---AQAKALAYSVFCYANHINELDKLGGLVEQIVTKHVSL---DILPEHYPIVGENLIAAIIEVLGDAFTPELQDAWVKAYGFLADLLI-GLEE 142
80 7.000e-44UniRef50_A0A1Y5ESK5 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5ESK5_9GAMM  ali  15  2.LDSNTINTIKATLPAV--QAHAEQITACFYPLMFEQYPEVKSFFNQTNQANG---TQSKALANAVIAYAANIDQLGNLSEAISKIVQKHCSLG---IQPEQYPIVGDCLLQAIKQVLGDAATEEVIAAWGKAYQQLADILIAAE.. 137
81 7.000e-44UniRef50_W7D677 Flavohemoprotein n=11 Tax=Listeriaceae TaxID=186820 RepID=W7D677_9LIST  ali  22  5..TEEQKQIVKSTAPILK--EHGKEITSIFYKKMFADHPELLNYFNLTNQ---EIGTQPLALANTVYLAAENIERLEVLLPQVKTIAHKHRSL---TIKAEHYPIVGEYLLKGIAEYLGDAATPEILDAWGAAYSIIANIFIEVEQE 141
82 7.000e-44UniRef50_A0A1Y2RB33 Hemoglobin n=1 Tax=Chitinophagaceae bacterium IBVUCB2 TaxID=1985174 RepID=A0A1Y2RB33_9BACT  ali  20  2.MTTEQTILVKTSWRMIRDI-DPAIVGDTFYSKLFCDTPALRKMFPK------NMDEQYRKLMDMLSTVAARLDNLNDLTEDILSMAQRHVQYG---VRPAHYKLVGKALLWTLQQGLGKDWTEEVKVAWTTCYSTLADTMIAA... 134
83 7.000e-44UniRef50_P15447 Globin, monomeric component M-IV n=5 Tax=Glycera dibranchiata TaxID=6350 RepID=GLB4_GLYDI  ali  92  2GLSAAQRQVVASTWKDIAGSDNGAGVGKECFTKFLSAHHDIAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGYKHIKAEYFEPLGASLLSAMEHRIGGKMTAAAKDAWAAAYADISGALISGLQS 148
84 1.000e-43UniRef50_UPI0007EE5E86 hemin receptor n=1 Tax=Rhizobium TaxID=379 RepID=UPI0007EE5E86  ali  20  1.MNPHNISLVQQSFKKLVPTAD--QVGLMFYGRLFETFPEVRPLF------AEDIGPQSKKLVQMLALVVGGLDKLDAILPAVKDLARRHKGYG---VVEGHYEAVGLTLIWTLRRGLGDAFTPEVEGAWSEAFGALSGVMIAAANE 135
85 1.000e-43UniRef50_A0A2E3CUM4 Hemin receptor n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A2E3CUM4_9GAMM  ali  27  1.MTPEQITKVQTTFDMVEPIADKA--AELFYGRLFEIAPEVRPMFKS------DMSEQGAKLMRMLGIAVRGLTKLETIVPAVQNLGVKHLEYG---VKEEHFQPVAEALLWTLEQGLGDAWDEEAKVAWTEAYVLLSTTMIDAM.. 133
86 1.000e-43UniRef50_A0A0Q9YP91 Flavohemoprotein n=37 Tax=root TaxID=1 RepID=A0A0Q9YP91_9COXI  ali  16  2.LDEYTIRIIKSTVPILE--KHAEQLTYHFYKRMFSHNPEVIPLFNSAHQSTG---HQQKALAGAICSYAANIDNLEALGSSIELIAQKHASL---QIKPKHYPIVGQNLLASIQEILGNGATDEVIQAWAQAYDFLANILIGRE.. 137
87 1.000e-43UniRef50_A0A1S2VJ89 Hemoglobin n=4 Tax=Bacteria TaxID=2 RepID=A0A1S2VJ89_9BACT  ali  25  1.MTGEQIQLVKTTWRLLREI-DPVLLGDVFYGRLFIDNPALQSLFKSP------MDEQYKKLIDTISVVVARLENLPELIPDIQALAQRHVQYG---VKPEQYDLVGAALLWTLEKGLGRDWTPAAAEAWSRCYHTLAQTMIN.... 132
88 1.000e-43UniRef50_A0A2R8AQT8 Bacterial hemoglobin n=23 Tax=Bacteria TaxID=2 RepID=A0A2R8AQT8_9RHOB  ali  23  1.MDDKQITLIQESFAKVVPIKDAA--AEIFYADLFETAPAVKPYF-----ANADMKDQGSKLMATLAVVVNGLRDLDKIVPVAQQLAVKHVDYG---VKAQDYDSVGASLLRTLEKGLGDDFTPEVKEAWTVAYTTLAGVMKGAA.. 134
89 1.000e-43UniRef50_A0A0L0N5X4 Flavohemoprotein n=1 Tax=Tolypocladium ophioglossoides CBS 100239 TaxID=1163406 RepID=A0A0L0N5X4_9HYPO  ali  24  2ALTAKQIAIVKSTAPVVK--EHGQTITRLFYKDMLAAHPELKNYFSLRNQQIG---AQQAALADAVFAYATHIDDLPRLGAAVERIAQKHASL---FIKPEQYPIVGKFLIGAFAKVLGGALTPEIKDAWVAAYGQLADVFIQREKQ 140
90 1.000e-43UniRef50_A0A2U3DXL3 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3DXL3_9HYPO  ali  22  856ALTAEQIAIVKSTAPVVKQ--HGRTITTTFYASMLGAHPELLNIFSVRNQHTG---AQQAALADAVFAYAAHIDDLAALRGAVERIAHKHASL---FVKPEQYAIVGEHLVGAFATVLGDALTDDVKDAWIAAYGQLADVFIQREKQ 994
91 1.000e-43UniRef50_A0A0N7LZA9 Nitric oxide dioxygenase n=142 Tax=cellular organisms TaxID=131567 RepID=A0A0N7LZA9_9RHOB  ali  23  1.MHESEIQLVQASFAKVAPIAD--QAAGIFYDRLFEIAPHVKPYFK------GDMKVQGAKLMTTLGVVVKGLRDLDKIVPVAQQLAIGHVAYG---VTPEDYAPVGEALIYALKTGLGDDFTPDTANAWIRAYETLSSAMIEAA.. 133
92 1.000e-43UniRef50_A0A2I1C704 Flavohemo protein n=1 Tax=Aspergillus novofumigatus IBT 16806 TaxID=1392255 RepID=A0A2I1C704_9EURO  ali  21  3.LTPEQVQIIKATVPVL--TEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSG---HQPRALAGALFAYASNIDNLGALGPAVELICHKHASL---YIKPDDYKIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMIGREAQ 140
93 2.000e-43UniRef50_A0A2G7GNZ9 Uncharacterized protein n=1 Tax=Chroococcales cyanobacterium IPPAS B-1203 TaxID=2049454 RepID=A0A2G7GNZ9_9CHRO  ali  20  4.....QVEVLEQSFERVKP--HANEFAASFYNNLLTDYPQLQHLF-----AKTDMEQQHQKLIMSLILVIGNLRNPEYLKITLKNLGERHVGYGTLQ---QHYPMVGAALLKTFESYLGTDWTPEVKQAWADAYGVLAEMMLEGAEA 135
94 2.000e-43UniRef50_A0A2N7GG17 Hemin receptor n=2 Tax=Vibrio sp. 10N.261.55.A7 TaxID=1880851 RepID=A0A2N7GG17_9VIBR  ali  20  7SITAIEKKLIQDSFSKVAPIAD--TAAEIFYGKLFEYDPSLKRLFKS------DMTSQGRKLMNTLGVAVKGLDDLESLVPVLEGIAIKHVRYG---VKIDDYTPVGNALIYALKTGLGDEFDTKTRNAWVKIYSTIATVMRSAA.. 140
95 2.000e-43UniRef50_Q7UIY1 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=HMP_RHOBA  ali  19  2.LSEKTIRIVKEITPLVAA--NAETITRRFYERMFEANPEVKAFFNQAHQHSG---GQQKALAGAICAYFTHIDNPAVLMPAVELIAQKHVSLG---IKPEHYPIVGSNLLAAIGDVMGDAATPEIVEAVSEAYGFLADIFIGRE.. 137
96 2.000e-43UniRef50_M2THC1 Uncharacterized protein n=6 Tax=Bipolaris TaxID=33194 RepID=M2THC1_COCSN  ali  22  4.LTPTQVQIIKSTVPVLA--EHGTAITSRFYHDMLQAHPELKNIFNNTHQATG---HQAQALAGSLYAYAANIDNLGKLSPAVELICHKHASL---FIRADQYDIVGKHLLSTMSSVLGAAATPEILDAWGAAYWQLANIMINKE.. 139
97 3.000e-43UniRef50_K9WM86 Family 3 adenylate cyclase n=4 Tax=Cyanobacteria TaxID=1117 RepID=K9WM86_9CYAN  ali  22  724.LAPTQVELVQSSFEKVKPIADRT--AELFYQRLFELSPSVRHLFK------GEMKEQERKLMHTLALAVEGLRQPENIIPAVQDLGRRHAGYG---VKTEYYDILSDALLWTLAQVLGVEFTAPVRKAWEEAYTFLSEIMKEAAAE 858
98 3.000e-43UniRef50_P39662 Flavohemoprotein n=98 Tax=cellular organisms TaxID=131567 RepID=HMP_CUPNH  ali  24  2.LTQKTKDIVKATAPVLA--EHGYDIIKCFYQRMFEAHPELKNVFNMAHQEQGQQQQ---ALARAVYAYAENIEDPNSLMAVLKNIANKHASLG---VKPEQYPIVGEHLLAAIKEVLGNAATDDIISAWAQAYGNLADVLM-GMES 138
99 3.000e-43UniRef50_A0A1Y5EC26 Methyl-accepting chemotaxis protein n=17 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y5EC26_COLPS  ali  22  1.MTPNQISLVQKSWQKVLPI--APQAAEIFYSTLFEMDPSLKALFPS------NIADQGKKLMAMLDTAVKLLDNPDKLIPAVQNLGAKHLKYGA---EPEHYDTVGAALLKTLAQGLGQDFTAPTKKAWTVVYQTLATTMITAAND 135
100 3.000e-43UniRef50_A0A1F7ZZ88 Flavohemoprotein n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A1F7ZZ88_9EURO  ali  23  3.LSPEQIQLIKATVPVLQQ--HGTNITTVFYSNMLTAHPELNAVFNNANKTNG---HQPRALAGALFAYASHIDDLGALGPAVELICNKHASL---YIQPDQYQIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMIGREAE 140
101 3.000e-43UniRef50_A6CH06 HMP (Fragment) n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6CH06_9PLAN  ali  20  2.LSAKTIQIVKEITPTVAA--NAETVTRVFYKRMFQENPEVQAYFNQAHQHSG---GQQKALAGAICAYFLHIDDLAALTPAVELIAQKHCSLG---IQPEHYPIVGKHLLAAIKEVMGDGATDEVLAAVGEAYQLLADVCIGRE.. 137
102 3.000e-43UniRef50_B0CEY8 Globin domain protein n=9 Tax=Cyanobacteria TaxID=1117 RepID=B0CEY8_ACAM1  ali  22  4.....QVEILESSFEKVKPQAN--EFVSSFYNHLFTDYPEAQPLF-----EGTDMEKQGGKLLQSLVLVIENLRKPDALGNALKGLGARHVKYGAL---PEHYPLVGATLLKTFEQYLGDAWTEEVQTAWVDAYGAITTIMLDGAD. 134
103 3.000e-43UniRef50_A9GV91 Probable bacterial hemoglobin n=2 Tax=Sorangium cellulosum TaxID=56 RepID=A9GV91_SORC5  ali  25  72.LSQRTIELVQWSWAKVMPISDAA--AALFYERLFTLEPSVRPLFKN------DIAEQKKKLMQTLSVAVDGLNNLPKLVPVLQALGVRHQGY---MVVDRHYDVVGEALLWTLREGLGDSFSADVESAWKEVYGVVSDVMKK.... 202
104 4.000e-43UniRef50_A0A090IE55 Flavohemoprotein n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A090IE55_9GAMM  ali  16  2.LTQHTIDIIKATVPAVSV--HANDITAHFYPLMFREYPEVKRFFNQSNQSGN---AQPKALANALVAYAGNIENLSVLEAAVNRIINKHVSL---NIQPEQYEIVGECLLKSIKAVLGDAATDEVIDAWGLAYWQLADLLIAAEEA 139
105 4.000e-43UniRef50_A0A1V3A045 Nitric oxide dioxygenase n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=A0A1V3A045_9GAMM  ali  21  6.....TREIVKSTVPVLA--EHGETITRRFYARMFEAHPELRNVFNQAHQAAGE---QPHALARAVMAWAEHIDEPQVLEDTVRRIAHKHVSL---RVTADQYAIVGEHLLGAMGEVLGEAATPEIVGAWEQAYWELARILIDAEQS 139
106 4.000e-43UniRef50_UPI000833C1D2 hypothetical protein n=1 Tax=Rhizobiales bacterium CCH3-A5 TaxID=1768796 RepID=UPI000833C1D2  ali  19  1.MTENDIALIRETFAHLHRRK--TETARIFYDRLFEIAPEVRPLFK------GDIKAQGAKLMETLLVAIATLNDRPGLTILLEKLGRGHRDY---HVEPRHYDNVGAALIWTLQTSLGDGFTPAVERAWTSLYADIAATMIGAAKA 135
107 5.000e-43UniRef50_A0A0X8GKV9 Uncharacterized protein n=1 Tax=Janthinobacterium sp. B9-8 TaxID=1236179 RepID=A0A0X8GKV9_9BURK  ali  20  2ALTDKDIALVRETLALVLPIADAA--AEMFYQHLFEIAPEVRPLFK------GDIKKQGAMLMSSIKLAVDNINKPEVLLPTIQKLGERHAKY---AVQEEHYTTVGHALLWTLEQGLADAFTDDVKKAWAATYTTLACEMIKAQRA 137
108 5.000e-43UniRef50_A0A0P1ILU2 Nitric oxide dioxygenase n=13 Tax=Bacteria TaxID=2 RepID=A0A0P1ILU2_9RHOB  ali  26  1.MDENAIQLVQDSFSKVVPIKDAA--AEIFYADLFETAPRVKPYF-----VNSDMKEQGSKLMASLATVVSGLRDLDKIVPVAEQMAVRHVDYG---VKPEDYDAVGASLLRTLEKGLGEEFTPSVKDAWTGAYTTLAGVMKAAA.. 134
109 6.000e-43UniRef50_A0A285U7Z8 Nitric oxide dioxygenase n=1 Tax=Salinicoccus kekensis TaxID=714307 RepID=A0A285U7Z8_9STAP  ali  16  1.MEPHKKEIIKATVPALE--EHGTTITTVFYQNMFKKHPDLLNMFNQTNQKVGD---QPKALAFTVLQAARHIDDLEAIVPAVIGIAHKHRAL---NVKPEHYPIVGENLLEGIKEVLGDAATPEIMDAWEEYYGEIAQIFIDVE.. 136
110 7.000e-43UniRef50_A0A0B3BTQ4 Flavohemoprotein n=669 Tax=root TaxID=1 RepID=A0A0B3BTQ4_9PSED  ali  18  2.LSQDTKDLIKATAPVLA--EQGSTIIRRFYQRLFEAHPDLRNLFNMTHQQRGQ---QQEALARAVYAYAANIEQPETLAAVLENIAHKHASLG---VRPDQYPIVGEHLLGAIKDVLQEAASQDILDAWAQAYGQLADLLT-GME. 137
111 7.000e-43UniRef50_UPI00077B149A neuroglobin-like isoform X1 n=2 Tax=Acropora digitifera TaxID=70779 RepID=UPI00077B149A  ali  24  105......ITRVQETWRSVKEAYKLEHIGLEFYLRLFTDSPELLQLFSFSDRNDKRLTRQGRVTMEHLDLAVSSLNNLGSIVPALKELGARHVMY---KVEEHHYEPVGAALLKTLHNGLGERFTPEVREAWTQVYKIVADTMKAGAKE 250
112 7.000e-43UniRef50_A0A1B8C2M8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. WSF 3629 TaxID=1622147 RepID=A0A1B8C2M8_9PEZI  ali  15  6.MTPEQINIILQTVPLV--QERAYDITTIFYQNMLSAHPELNSIFNTTSQRT---EHQARALAGALCAYAANINKLDALGPMLELICHKHASL---LIEPKQYSIVGKYLIEAMEQVLGEAFTPNIQAAWTTAYWQLAKIMIEKE.. 141
113 9.000e-43UniRef50_A0A128F1V6 Flavohemoprotein n=47 Tax=root TaxID=1 RepID=A0A128F1V6_9GAMM  ali  21  2SLTQQQITLIQTSFSKVEPIS--LKAAEIFYDTLFSYDPTLKPLFKS------DMKLQGRKLMAMLSAAVNGLNDLDSLVPVLHQLAERHEGYG---VKKSHFTPVGNALLHTLKVGLGDEYTPEVRAAWVALLHIVADTMKSKM.. 135
114 1.000e-42UniRef50_UPI0003776242 hypothetical protein n=1 Tax=Methyloferula stellata TaxID=876270 RepID=UPI0003776242  ali  22  1.MTPAEVDMVKTTFVQILPQAD--EFGPKFYERLFSLDPTLKEMFK------EDMAVQSKKLVRMLATLVAGLQSLETVVPTLEALAIRHVGYG---VRDEHYNVIGQSLIWTLEQQLGEAFTPEVRNAWIATYVLIAETMKAAARD 135
115 1.000e-42UniRef50_A0A2C5XD19 Uncharacterized protein n=4 Tax=Hypocreales TaxID=5125 RepID=A0A2C5XD19_9HYPO  ali  21  2ALTAHQVALVKSTAPVIK--EHGKTITSYFYKTLLAEHPELKNMFSLRHQQVG---AQQQALADAVFGYAAYIDDLDKLSAAVERIAHKHASL---YVRPEHYPIVGEYLVRAFEQVLGAALTPEIKEAWVAAYGQLADVFIGREKQ 140
116 1.000e-42UniRef50_UPI000C03F59C neuroglobin-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03F59C  ali  23  70..SQKQISLVQETWGLVSG--DLEKVGVDFYMRLFKANPDVLQLFSFRDRADDRLKRQGLVTMQHVDLAVNSLNDLGSIVPALRDLGGRHAMY---KVEEHHYVLVGSVLLDTLNNGLGDNFTVEVKEAWTGVYGIVANTMQAGARE 218
117 1.000e-42UniRef50_A0A1I6RIH7 Flavohemoprotein n=1 Tax=Marininema halotolerans TaxID=1155944 RepID=A0A1I6RIH7_9BACL  ali  20  2.LDERTIQIIKSTAPIIK--EHGEEITRCFYQRLFHRHPELLNYFNQANQRQG---RQQQALANAVWAVAENIDQLEKVLPMVEGIAHKHRALG---VKAEQYPIVGENLLIAIQKVLGLSPTDEIMKAWEQAYGVIAEVFIGKEAE 139
118 1.000e-42UniRef50_A0A2N6NCZ4 Flavohemoprotein n=11 Tax=Sordariomycetes TaxID=147550 RepID=A0A2N6NCZ4_BEABA  ali  18  42..TQSQIDIVKSTAAILKDQGD--RITRIFYVNMLTAHPELKNYFSLRNQATG---AQQAALGASVLAYASYIDDLPRLTSAVERIAHKHASL---FVRPEQYAIVGEHLVGAFAEVLGDALTPEVADAWKAAYAQLADVFIGRERQ 178
119 1.000e-42UniRef50_A0A177W3W1 Flavohemoprotein n=4 Tax=Piscirickettsiaceae TaxID=135616 RepID=A0A177W3W1_9GAMM  ali  13  2.LSEHTKTIVKATAPVMK--EHGLTITLRMYDIMFARYPKTKTLFNQTHQEN---KQQPRALANSIYAYAANIDNLDALGDAVELIAHKHASL---NILPEHYDIVAECLIQAVKDILKEAATTEIITAWTEAYTFLANVFINREEE 139
120 1.000e-42UniRef50_D3SCW1 Flavohemoprotein n=28 Tax=Proteobacteria TaxID=1224 RepID=D3SCW1_THISK  ali  17  2.LSDDHKAIIQKTVPILESG--GEDLTRHFYSIMFRDYPEVRPLFNQAHQASGQ---QARALANAVLQYARHIDEMEALGPLVGQIVNKHVSL---QVQPEHYPIVGECLLRAMRELLGEEATDAVLEAWGAAYQQLADILIAAEED 140
121 2.000e-42UniRef50_UPI000852A369 hypothetical protein n=2 Tax=Thermogemmatispora TaxID=768669 RepID=UPI000852A369  ali  19  5........LLKESFGLIAPQK--EAFARQFYERLFATYPQTRPLF-----ANTDMRRQESALMATLAAVVAGVERGENLVPVLHKLGERHYRYG---VQPEHYPLVGQALIATFVDFLGPRFTPAMQDAWVQAFEVISSQMIAA... 130
122 2.000e-42UniRef50_A0A128FGE6 Flavohemoprotein n=25 Tax=Bacteria TaxID=2 RepID=A0A128FGE6_9GAMM  ali  20  2SLKQQQITLIQTSFNKVEPIS--VKAAEIFYDTLFSYDPTLKSLFK------GDMKQQGRKLMAMLSAAVKGLNDLESLFPVLHELAQRHEGYG---VKKSHFTPVGNALLHTLKVGLGDDFTPEVRAAWVTLLHIVADTMKSKM.. 135
123 2.000e-42UniRef50_UPI000B9B7971 hypothetical protein n=1 Tax=Hydrocoleum sp. CS-953 TaxID=1671698 RepID=UPI000B9B7971  ali  20  5......IEIIEQTFAQIKP--NAEKFAASFYVNLFREYPELKPLF-----VNTDMEKQQKKLLDALILVVENLRHGEVLKGVIEALGARHVNYG---VLQQHYPAVGKALLETLKEYLQENWNSEVKAAWVSAYRGIAKLMLKGA.. 133
124 2.000e-42UniRef50_Q7SDB4 Flavohemoglobin n=28 Tax=Sordariomycetes TaxID=147550 RepID=Q7SDB4_NEUCR  ali  20  2ALTYQQSKLVRDTIPALK--EHGERITSIFYKTMLTDHPELNNYFNSVNQKNG---RQPRALTAVILGFASNINHLSELVPKFERMCNKHCSLG---IQPEHYEVVGKYLIQAFGEVLGPAMTPEVQTAWTKAYWMLAKMLIGREAQ 140
125 2.000e-42UniRef50_I2GB73 Hemoglobin n=9 Tax=Cytophagaceae TaxID=89373 RepID=I2GB73_9BACT  ali  21  1.MTIQEINIVKRTWKLLRDV-DPQLLGDVFYRRLFLTYPSVRPMF------REPMTTQYHKFVDMLSLIVSRIDRPEEVMSEIAQLAQRHERYG---VKPEHYPVVGETLLWTLEQGLGNQWNNDVKQAWEACYQTLVQAMLEKA.. 134
126 2.000e-42UniRef50_B3DUZ7 Hemoglobin-like flavoprotein n=3 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepID=B3DUZ7_METI4  ali  20  3..DQKEKELIKESWKRIEPNKN--EIGLLFYANLFKEEPTVSVLF------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYG---VVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTA.... 132
127 2.000e-42UniRef50_A0A1P8FQ56 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FQ56_9PROT  ali  25  1.MTPEQIALVQNSWKKIVPFKDMAAV--LFYGRLFELNPSLKPLFGKP------MDLQGRKLMAMIGTAVGCLGRMHELSPGMDGIGQRHAVYCL---KDEHYETVAQAFLWTLEQTLDTDFTLEVREAWTVAYTTLANVMKDA... 132
128 2.000e-42UniRef50_A0A2P8VSJ7 Globin n=1 Tax=filamentous cyanobacterium CCP5 TaxID=2107701 RepID=A0A2P8VSJ7_9CYAN  ali  22  167......IALLEQSFEKVKPQAN--EFVGSFYENLFTDYPAAKPLFTHTN-----MKEQGNKLLMSLVFVIDNLRKPGELTNALKGLGARHVKYGAL---PDHYPLVGNSLLKTFEQYLGSDWTPETKAAWVDAYGLITEVMLDGAD. 296
129 3.000e-42UniRef50_A0A1H7KTF8 Hemoglobin-like flavoprotein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1H7KTF8_9BRAD  ali  21  1.MTPQDIALVRSSFAQLHRRK--IETACLFYERLFTTTPGARALFK------TDIETQAAKLMETLMVALATLNDPGGLKVLLNRLGERHQGYG---VQPEHYDAVGSALLWTLETSLGPDFTPQTRAAWTELYELMAKTMLSAA.. 133
130 3.000e-42UniRef50_F1A2R8 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=F1A2R8_DICPU  ali  24  2.LSPKTVQVIKSTVPVLEQY--GVQITSTFYKNMFAAHPELLNIFNHSNQREGK---QQTALANTVYAAALHIDKLPEILPAVKQIAHKHRALG---IVPAQYDIVGANLLGAIKQVLGDAATDEIIGAWAEAYGVIAKVFID.... 135
131 3.000e-42UniRef50_A0A2K9UYP1 Globin-like protein n=3 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYP1_ACTTE  ali  22  49.LDPASIKLIRESWSEVE-KGDLQETGLVVFRRLFEIAPYLRDLFPFGYNPDGDLKAHALGVMSTVGVAVRGLDDLESLKPKLVELGALHKGF---EITDKEFKHVGEAIIWTLDKGLGDQFTPEVKAAWVEAYGLITTTMKEGLK. 190
132 3.000e-42UniRef50_A0A2W4SAM4 Hemin receptor n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2W4SAM4_9RHIZ  ali  18  28AMTDEDITLVRESFAQLHRRRN--ETSELFYARLFEIAPDVRPLFKA------DLAAQRVNLMEFLAVAMATLRDPKGLTVLLKKLGRNHRGYG---VQERHYDQVGAALIWTLRTSLGAGFTPELERAWTSLYGEMANTMIAA... 160
133 3.000e-42UniRef50_A0A2H1YC60 Flavohemoprotein n=12 Tax=Bacteroidetes TaxID=976 RepID=A0A2H1YC60_9FLAO  ali  19  3..SKKTIEIVKSTVPVLEV--HGEAITKVFYRLLFENHPELKDIFNMTNQKKGN---QQIALASAVFKYAQHIDKLEMLGGMVNTIAQKHVSL---SIPKEAYPIVGENLLAAIKEVLGDAATPEIIDAWAEAYGDLAAIFVGKEEA 139
134 3.000e-42UniRef50_A0A2D1U1Z3 NO-inducible flavohemoprotein n=1 Tax=Pedobacter ginsengisoli TaxID=363852 RepID=A0A2D1U1Z3_9SPHI  ali  15  1.MNIKQEQLISATVPVLR--ENGVLLTTHFYNRMFTHNPELKNMFNMGNQESGK---QQTALAMAVLAYAENIANPGVLMPVVDRIGHKHVSL---DIRPEHYQIVGRHLIASIQEVLGAAATPDILEAWTVAYQQLATLM...... 132
135 3.000e-42UniRef50_A0A0F7D450 Flavohemoprotein n=24 Tax=Staphylococcaceae TaxID=90964 RepID=A0A0F7D450_9STAP  ali  19  7......KQIIKETVPVLE--EHGTEITTVFYKRMFEAHPELLDIFNKTNQKVGD---QPKALAMTVLAAARHIEDIETIVPAVMGIAHKHRAL---DVKPEHYPIVGKYLLEGIREVLGEAATPEIIDAWGEYYGKIADVFIGIEKE 139
136 3.000e-42UniRef50_UPI00024838DF globin domain-containing protein n=1 Tax=Acaryochloris sp. CCMEE 5410 TaxID=310037 RepID=UPI00024838DF  ali  22  4.....QVEILESSFEKIKPQAN--EFVSSFYNHLFTDYPEAKPLF-----EGTDMEKQGGKLLQSLVLVIENLRKPDALSNALKGLGARHVKYGAL---PEHYPLVGATLLKTFDEYLGDAWTEEVQTAWVDAYGAITTIMLDGAD. 134
137 4.000e-42UniRef50_A0A2W2KUB6 Uncharacterized protein n=1 Tax=Streptomyces sp. NTH33 TaxID=1735453 RepID=A0A2W2KUB6_9ACTN  ali  25  37AMTA-DLSLIRSSFAAVQP--HGSQVTAYFYDHLFAHHPGVRPLF------ATHLDEQRDRLWAALGALVVNLENTDTLTGMLQNLGRRHAGYGAL---AEHYPAVGASLIATLRHYAGDAWTPAAEESWAAVYDVISSTMIEAGKA 171
138 4.000e-42UniRef50_A0A1Z4RR64 Putative globin-like protein n=1 Tax=Chondrocystis sp. NIES-4102 TaxID=2005460 RepID=A0A1Z4RR64_9CHRO  ali  19  117..SHQSVEIVKSTAPVLKQ--HGKTITTRMYEIMFNQYPEVKTQFDQSAQANGS---QPAKLANAVYSYATHIDDLEALKAMVDKIAHRHV---DSHVLPQQYPIVGECLLQAIKDVLQDAATPEVMQAWTEAYQLLAEVFINREQQ 253
139 4.000e-42UniRef50_M7NY13 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Methylophaga lonarensis MPL TaxID=1286106 RepID=M7NY13_9GA  ali  15  1.MNSSQIEIIKQTVPVL--QEHGETLTRRFYENMFRNNPEVKDFFNPAHQQAG---TQQRALAGAICAYAANIDNLSALSGAVDLIAHKHVSLG---IKPEHYPIVGQNLILTIQEVLGEAANEAIIEAWTVAYQELARIFV..... 133
140 4.000e-42UniRef50_A0A2G3JEF9 Hemin receptor n=1 Tax=Iodobacter sp. BJB302 TaxID=1506510 RepID=A0A2G3JEF9_9NEIS  ali  21  3.LSDKDISLVKETLALVLPIAD--TAAEMFYQHLFEIAPEVKPLFK------GDIKKQGAMLMTSIKLAVDNINKPEILLPAIQKLGERHAHY---HVQEEHYTTVGQALLWTLEQGLADAFTSDVKSAWAATYTTLACEMIKAQR. 136
141 4.000e-42UniRef50_A0A1A8T8H1 Flavohemoprotein n=16 Tax=Bacteria TaxID=2 RepID=A0A1A8T8H1_9GAMM  ali  20  2.LSQTHIDTVKATIPVLASA--GTAITEHFYNRMFTHNPELKDVFNMSHQATG---RQPAALFNAIAAYATHIDNLEVLTGAVMRIAHKHTSF---NIQADQYAIVGHHLIETLRELLGEAFTPAIEEAWGAAYQQLADIFIK.... 135
142 4.000e-42UniRef50_A5DQY8 Uncharacterized protein n=2 Tax=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324  ali  21  14.LSPEQVNIVKASVPILKAS--GQELTKNFYQKMLSSYPEVKPFFNESDQKS---LRQPKILAFALLKYAENIENLEPLTGFVQQIVTKHVGL---QVKPEHYPIVGTCLLNTMENMLGELATPEFLQAWATAYGNLARLLINAED. 150
143 5.000e-42UniRef50_UPI000933B364 flavohemoprotein n=2 Tax=Cyanobacteria TaxID=1117 RepID=UPI000933B364  ali  23  4.....QVECLEQSFEKVKP--NADAFVTSFYDNLTTMYPEAAPLFS-----STDMAAQKKKLLASLVLVVENLRNPDALTDALHGLGARHVKYGAL---PEHYPLVGNALLKTFEDYLQDDWTAEVKQAWVDAYGAIAELMLAGAD. 134
144 5.000e-42UniRef50_A0A1I3T1A6 Hemoglobin-like flavoprotein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1I3T1A6_9BRAD  ali  20  4...DDDVQRIRESFAHLHRRK--AETGEIFYNRLFEIAPEVRPLFK------GDMKAQSVKLMEMLTVAIATLNDREGLAILLRKLGREHKGYG---VKDSHYDRVGEALIWTLRTSLGDAFTPRLEQAWTQLYTDIADVMIAA... 133
145 6.000e-42UniRef50_A0A1Z4SE05 Putative globin-like protein n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4SE05_9NOSO  ali  21  3..SQQTIDIVKSTAPVLK--KNGQQITTRMYEIMFQNHPEVKEQFDMSAQANGS---QPAKLASAVYSYATQIDNLPALKSMVEKIAHRHV---DTHVLPEQYPIVGESLLQAIKDVLGEAATEEVMAAWTEAYQALSEVFINREHE 139
146 6.000e-42UniRef50_UPI0004B49BE6 hemin receptor n=1 Tax=Solimonas soli TaxID=413479 RepID=UPI0004B49BE6  ali  24  1.MNPSQIAMVQASWQQVLPMRR--QAAALFYGRLFSLHPHLRALFHSP------IAEQGEKLINMIDAAIGNLDRLDQLMPVIHALGARHQGYG---VQPDHYVAVGGALLWTLEQGLGAAFTAELCEAWTEVYSALAAAMLDGA.. 133
147 6.000e-42UniRef50_A0A139X0Z2 Globin domain protein n=1 Tax=Scytonema hofmannii PCC 7110 TaxID=128403 RepID=A0A139X0Z2_9CYAN  ali  20  683.MSMSKVDLVQSTFAKVQPIAD--TVAELFYQRLFELSPSLRPLFK------GSMEDQQRKLMSTLAIAVEGLRQPQAIIKAVQQLGKRHADYG---VMAQYYDVVGEALLWTLEQGLGEAFTPQVRRAWEEAYKFLSEIMKDAAAQ 817
148 6.000e-42UniRef50_A0A1V5NS93 Flavohemoprotein n=1 Tax=Bacteroidetes bacterium ADurb.Bin397 TaxID=1852812 RepID=A0A1V5NS93_9BACT  ali  26  2.LTAKQIELVQNTWSTITPVS--QQMGESFYSRLFQNHPELKPMFKS------DPKDQAMKLMFMISYLVHRLGSFDDLKDEIIKLASRHTGYGT---KKEHYGAVGDALLATLKESLGKSWTPETEAAWTDTYMLIAGLMQQA... 133
149 7.000e-42UniRef50_G4QHE2 Methyl-accepting chemotaxis protein n=2 Tax=Glaciecola TaxID=89404 RepID=G4QHE2_GLANF  ali  25  1.MTIKQSIVVQKSWQKLKPI--APQAAKIFYETLFEMDPSLKPMFK------GDMVEQGNKLMSMLDAAIKLLDDPDKLIPAVQKLGERHVSYG---VKPEHYSTVGAALLKTVETGLGDEYTTTVKRAWTAVYKTLADTMI..... 130
150 7.000e-42UniRef50_U7Q638 Uncharacterized protein n=4 Tax=Sporothrix TaxID=29907 RepID=U7Q638_SPOS1  ali  18  31..TPEQISIVKATAPVLK--EHGVTITTVFYENMLKENPELKNVFSLTSQATG---AQPRALAAAVLGYAMFIDDLPRLHHAVERIAHKHASL---QIQPDQYDIVGKYLIQAIGQVLGDAATPSIVDAWTAAYGVLADVFIGRERS 167
151 7.000e-42UniRef50_UPI00040E3AFA NO-inducible flavohemoprotein n=1 Tax=Bacillus aurantiacus TaxID=254410 RepID=UPI00040E3AFA  ali  20  6.LSTQSKEIVKASAPIL--QEHGEKVTQTFYHNLFQAHPELLNIFNETHQKKGK---QPMALANTLYAAAVNIERLEELLPAVKQIAHKHRSL---NVLPEHYPIVGKYLLEAMREVLGE--SPEVIQAWAEAYGIIADIFINVEKE 144
152 7.000e-42UniRef50_UPI0009DE34DE hypothetical protein n=1 Tax=Thermogemmatispora carboxidivorans TaxID=1382306 RepID=UPI0009DE34DE  ali  18  44........LLKESFGLIAPQK--EAFARQFYERLFATYPQTRPLF-----ANTDMRRQEGALMATLAAVVAGVERGENLGPVLHKLGERHYRYG---VQPEHYPLVGQALIATFVDFLGPRFTPAMQDAWVQAFEVISSQMIAA... 169
153 7.000e-42UniRef50_A0A2K9UYS1 Globin-like protein n=3 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYS1_EXAPA  ali  22  30..SDSKKNIIVQTWKLVEPVK--VAAGKKLFSRLFELNPSLQDTFPAFKLNSRSLYLHAKRVMGAVENAVSSLNDSEAFTSYLSNLGARHI---PWNMQKEHFNIVGECLLWTFQDMLGTACTTEVAEAWAELYGYIVQSMLDGMKS 176
154 8.000e-42UniRef50_UPI00042825D3 hemin receptor n=2 Tax=Bacteria TaxID=2 RepID=UPI00042825D3  ali  21  1.MTPEQIDAVQASFRQVAAVR--EDAAAQFYDRLFTLDPGLRPLFK------GDMAEQQRKLMATLGLAVGSLKAPEALAGPLRELGARHRDYG---VQDEHYATVAEALLWTLERNLGPAFTDDVRGAWVALYGMVAEGMRR.... 131
155 8.000e-42UniRef50_A0A1W1HMZ7 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=2 Tax=Nitrospira sp. ND1 TaxID=1658518 RepID=A0A1W1HMZ7_9B  ali  23  5......VELLESSFKLVAPKGD--ALVTRFYERLFKKYPSVKPLFKKT-----SIKEQKKKLLASLVLVIQNLRRPDKLTSVLQDMGARHVGYG---VKPAHYDAVGENLLAVLGEVAGPAWTPQVKQAWTEAYGAIKTIMLAGAE. 134
156 8.000e-42UniRef50_UPI000DAC7A24 hemin receptor n=1 Tax=Rhodobacteraceae bacterium DSL-40 TaxID=2219044 RepID=UPI000DAC7A24  ali  27  1.MTPDQIGLVKQSYYLIAPVSH--QAAGLFYGRLFSVAPEVRPLFDRAN-----MFTQADKLWATLGKIVDVLDRPEALEPAAAKLAVSHLHYG---VMPEHYAPVGDALVWALEQGLGESFNPEVRDAWTAAYDHISQAMISA... 133
157 9.000e-42UniRef50_A0A076P2E8 Flavohemoprotein n=66 Tax=Bacteroidetes TaxID=976 RepID=A0A076P2E8_FLAPS  ali  15  10.MTSTQKDLIKATIPILK--SNGEDLVKYFYNRMFIHNPELKNLFNMGNQSSGK---QQSALTGAVLAYAENIDNPTVLINTLKLIGNKHVSL---QVTAKQYDIVGNHLIASIKEVLGETATEELLHAWTIAYTQLAQIMIDIEE. 147
158 9.000e-42UniRef50_K9SG59 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=K9SG59_9CYAN  ali  18  5......VKLLEDSFDRIKPKAR--AFSASFYHNLFEMYPVAKPLF-----ANTDMIAQREKLIKSLVLVTSNLRSPDVLTETLAGLGSRHVEYGAL---PEHYPLVGNALLATFEEYLGTAWTEEVKQAWVEAYAAITELMLEGAD. 134
159 1.000e-41UniRef50_A5EIC9 Putative globin-like protein n=6 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A5EIC9_BRASB  ali  22  2.LTAEEIACVRSSFDMVFA--NATDMTTTFYQRLFELAPECRSMFP------DNMDVLKRDFIATLAVLVGSLDRMTGLLSSTDILGRNHARYG---VRPEHYPLVGEALLWSLAKGLGPQWTAEVEQAWRKVYEIISQRMIA.... 132
160 1.000e-41UniRef50_A0A2G1WCW5 Flavohemoprotein n=1 Tax=Rhodopirellula bahusiensis TaxID=2014065 RepID=A0A2G1WCW5_9PLAN  ali  21  2.LSENTIRVVKEITPVVAA--NAETITRRFYERMFEVNPEVKVFFNQSHQHTG---GQQKALAGAICAYFTHIDNPAVLLPAVELIAQKHCSLG---IKAEHYPIVGANLLAAIQDVMGDAATDEIMDAVEEAYGFLADIFIGRENE 139
161 1.000e-41UniRef50_A0A1J5KJN2 Uncharacterized protein n=1 Tax=Bacteriovorax sp. MedPE-SWde TaxID=1860085 RepID=A0A1J5KJN2_9PROT  ali  18  4.....DIKIIRDSFAQAKPIAD--QVADKFYEFLFADYPAAQPLF-----ENVNMAKQKKQLMGGLSHIVDSLDKPEELTKYLKSSGQRHVKYGT---KEEHYPLVGNTLIKTFAHFFGDAWTPELQQQWLWAYEFIANTMIEGAKE 135
162 1.000e-41UniRef50_R1FSQ6 Uncharacterized protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1FSQ6_EMIHU  ali  26  4...PDTIPELRSSWS--------AAVGVLFFKRIFEIAPGALELFSFRDVPAPELKSHALKVMNTVGVAVSMLDDVPALLPVLEGLGKKHVDYG---VVPAHYEVVGQALLDTLALGLGDAFTPELKAAWAEIYGVVSSTMIKGA.. 140
163 1.000e-41UniRef50_F8I6Y7 Nitric oxide dioxygenase n=1 Tax=Sulfobacillus acidophilus (strain TPY) TaxID=1051632 RepID=F8I6Y7_SULAT  ali  17  26..DQNTIDKVKATVPLLKGR--AEELGTRFYRHLFAEYPELQNVFNHAHQAT---LKQPRALAESVLGAAENLDNATYLRDAIQTIAHKHRSL---EVKPDHYPIVGRVLLQTLAESLGPAATPDTITAWATAYEFIADVFIQAE.. 160
164 1.000e-41UniRef50_A0A0B4EVF2 Flavohemoglobin (Fragment) n=24 Tax=Hypocreales TaxID=5125 RepID=A0A0B4EVF2_METAN  ali  21  6..TAEQIAIVKSTAPIIKQ--HGRAITDAFYTNLLSVHPELKNYFSLRNQQTG---AQQLALANAVFAYAAYIDDLAKLSEAVERIAQKHASL---FIQPEHYPIVGKFLVEAFVQILGSAVTEEIKDAWIAAYQQLADIFIQREQQ 142
165 1.000e-41UniRef50_A0A1W1UB38 Nitric oxide dioxygenase n=4 Tax=Deinococcus TaxID=1298 RepID=A0A1W1UB38_9DEIO  ali  24  7SLTPQQMALVQGSLA--RALPEASEVAGLFYDRLFALDPSLRALF------LGDMAAQGRKLVDTLDVFAGDLTRLPALRPAMRRLGQRHADYG---VRPEHYATVSEALLWALEQALGEGFTPEVRGAWEAAYAVIAREMLSG... 139
166 1.000e-41UniRef50_UPI0008326626 hemin receptor n=1 Tax=Pseudoruegeria sabulilitoris TaxID=1510458 RepID=UPI0008326626  ali  25  1.MNQSQITLIQQSYAKLVPSK--QQAGEIFYAKLFEIAPEVRPLFK------ENVTEQAGKLMTMLGTVVNGLRDLHKVTPIARKMAVEHVGYG---VKPAHYEPVGAALIATLEAGLGEDFTLETREAWVEAYSILSTAMIDAAKA 135
167 1.000e-41UniRef50_K9T9X7 Hemoglobin-like flavoprotein n=2 Tax=Pleurocapsales TaxID=52604 RepID=K9T9X7_9CYAN  ali  22  6.......DVLEKSFNLVEPRAN--EFAASFYETLFTDSPEAKPLF-----ANTDMEKQQQKLIMSLVYVVTNLRYPEELTKVLREMGEKHATYGA---KAEHYPIVGAALLKTLEAYLGADWTPEVKQAWTDAYEEISYLMLEGAK. 134
168 1.000e-41UniRef50_D8PFN9 Globin-coupled methyl-accepting chemotaxis protein (Modular protein) n=4 Tax=Nitrospira TaxID=203693 RepID=D8PFN9_9BACT  ali  22  4.....HIELLESSFKLVAPQGD--ALVTRFYERLFEKYPAVKPLFK-----NASISEQKKKLLASLVLVIQNLRHPEKLTPVLQDMGARHVGYGA---KPAYYDAVGENLLAVLGEFAGEAWTPEVKQAWTDAYAAIKTIMLEGAK. 134
169 1.000e-41UniRef50_H1V620 Globin n=17 Tax=Sordariomycetes TaxID=147550 RepID=H1V620_COLHI  ali  20  2ALTYKQSQLVKGTIPALR--EHGETITSIFYANMLRAHPELHDHFNKVNQANG---RQPRALTGVILAFAANLNHISELIPKLERMCNKHCSLG---IQPEHYDIVGKYLIQAFGQVLGPAMTPEIREAWTKAYWLLAKMLIGREAQ 140
170 1.000e-41UniRef50_A0A1K2FKH4 Bacterial hemoglobin n=25 Tax=Streptomycetaceae TaxID=2062 RepID=A0A1K2FKH4_9ACTN  ali  25  1.MTA-DIALIRSSFAAVQP--HGSQVTEYFYDHLFTHHPGVRPLF------AAHLDEQRDRLWAALGALVANLENTDTLMGMLQNLGRRHAGYGAL---AEHYPAVGASLIAALRHHAGDAWTPAVEESWTAVYGVISSTMVAAGEA 134
171 1.000e-41UniRef50_A0A0C1N7H3 Flavohemoprotein n=27 Tax=Cyanobacteria TaxID=1117 RepID=A0A0C1N7H3_9CYAN  ali  19  5......VELLEQSFAQIKPR--AEDFVASFYENLFASHPEAKPLF-----ANTNMVEQRQHLLAALVLVVQNLRKPEVLEEALKKLGAKHISYGTA---PEHYPLVGQALLTTFEQYLQQDWTSEVEQAWTDAFGAITALMLKGAEE 135
172 2.000e-41UniRef50_M7XWG2 Uncharacterized protein n=6 Tax=Methylobacterium TaxID=407 RepID=M7XWG2_9RHIZ  ali  24  705..SATQVERVQASFAKVRPIAD--TAADLFYERLFAIAPQVRPLFPA------DMTVQKRKLMAMLALAVANLDKPEALVSAVTDLGLRHRGYGTH---EAHYEAVGAALLWTLEQGLGADFTPEIREAWAETYGVVAGLMRSAA.. 836
173 2.000e-41UniRef50_A0A1C3SHN7 Flavohemoprotein n=35 Tax=Bacilli TaxID=91061 RepID=A0A1C3SHN7_9BACI  ali  22  2.LDKETIQIVKSTAPILK--EHSQEIGKRFYELLFSKVPELHNMFNQTNQKRG---IQQEALAYAVYAAGENIDHLEALEPVIKRITEKHRAIG---VKPEQYPIVGETLLAAVKDVLGDAATEEVLEAWKKAYGEIAKAFIN.... 135
174 2.000e-41UniRef50_A0A0S7DZ55 Flavohemoprotein n=17 Tax=Aspergillus TaxID=5052 RepID=A0A0S7DZ55_9EURO  ali  20  166....DTIQIIKATVPVL--TEHGTTITTVFYKNMLTAHPELNNVFNTAHQVSG---HQARALAGALFAYASNIDNLGALGPAVELICHKHASL---YIKPDDYKIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMIGREAQ 300
175 2.000e-41UniRef50_N6V4P8 Flavohemoprotein n=256 Tax=Bacteria TaxID=2 RepID=N6V4P8_9RHIZ  ali  18  5.LSAATKAIVRATVPALAA--HGTEITAAMYLLLFKDE-EVRNLFNQSHQ--GEGGGQAKALAQAILAYAQNIDNLAVLGPAVERIAQKHVGL---QIQEHHYPHVANALLAAIKQVLGDAATDEVLAAWGEAYWFLADILIGREKQ 142
176 2.000e-41UniRef50_A0A0Q0CYB3 Flavohemoprotein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q0CYB3_PSESS  ali  19  2.LSTAHRDIIKATVPILETG--GEALTTHFYRIMLDEYPQVRPLFNQANQASG---AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVAL---QILPEHYPVVGACLLRAIREVLGAEATDAVIDAWAAAYQQLADMLINAERD 140
177 2.000e-41UniRef50_B4WU25 Globin domain protein n=1 Tax=Synechococcus sp. (strain ATCC 29403 / PCC 7335) TaxID=91464 RepID=B4WU25_SYNS7  ali  24  716....RQVELVQRSFAKVEPIS--EQVGKLFYEHLFETRPDFKPLFS-----STDMETQQRKLMMTLATAVEGLRHPEEIISKVQALGRSHQGYG---VKAEDYEAIGATLLWTLKEKLGDDFTPEVKRAWEVAFQFLSKIMINAAAQ 848
178 2.000e-41UniRef50_A0A2G7DQ60 Hemoglobin-like flavoprotein n=9 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2G7DQ60_9ACTN  ali  26  28........LIKTSFAVVEP--HGSEVTAYFYTHLFEHNPDVRKLF------AEHMNEQQDRLWAAIGTLVNKLEDTDTVVNVLQGLGRRHAGYGAL---PEHFPAVGASLLASLAHFAGDAWTPEIEAAWTALYGVVTDVMSAAL.. 153
179 2.000e-41UniRef50_F8ELZ1 Globin n=3 Tax=Runella TaxID=105 RepID=F8ELZ1_RUNSL  ali  17  1.MDDQQKKLVQTSFARVVP--KAEYAAQLFYKRFFELAPEVESLFNS------ELKTQGIKLFQVISFTVCSLDNMDELLPLLQDLGRQHVKYGA---EEHHYGYVGEALLWTLEKVLKEDFTPEIQQAWTDVFRVMSDTMIEAA.. 133
180 2.000e-41UniRef50_UPI000DBEB0C6 NO-inducible flavohemoprotein n=1 Tax=Echinicola strongylocentroti TaxID=1795355 RepID=UPI000DBEB0C6  ali  16  1.MTQKTIDIVKSTAPVLK--SHGEQITRVFYEELFKHHPELKNMFNMTHQATGN---QPKVLAMTIIKYAEHIDQLDMLTDTVNVIVQKHSSL---DVRPEMYPIVGKYLLEAIKTVLGDMATAEILGAWEEAYQLLAQLFIGKEE. 138
181 3.000e-41UniRef50_A0A1Y0D3Y9 Flavohemoprotein n=14 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y0D3Y9_9GAMM  ali  19  2.LDSRTREIVKSTVPLLEAAN--TALTEHFYKRMFRDNPELKDVFNLSNQASG---RQPAALFNAVLAYAKNIDNPAVLASAVERIAQKHTGF---AITPSQYDIVGHHLLETIKELAPDAATPEVIDAWAQAYGALAGLFIGREEQ 139
182 3.000e-41UniRef50_H8Z1I5 Hemoglobin-like flavoprotein n=2 Tax=Chromatiaceae TaxID=1046 RepID=H8Z1I5_9GAMM  ali  20  1.MTSDDIALVRTSWAQLQPQ--AEQVGAALYQRMFNDHPELRRLFK------GEMDEQAHKLMRMVNRTVDTLDDLTSLNRVIIMMGARHSGYG---VEDEDYPKMRNALVATLDTHLGSEFTPETRSAWISVYGELAELMMEGA.. 133
183 3.000e-41UniRef50_A0A0U3MPE4 Hemin receptor n=3 Tax=Pannonibacter TaxID=227873 RepID=A0A0U3MPE4_9RHOB  ali  22  1.MTPEQIQLVQASFDRLRPQ--GTAVISGFYGRLFELSPSLRPLF------RTSLPAQEQRLLEALSAVVSMLSNLQMLLPELEALAKRHVTYG---VSAAHYQAAGDALLWTLESHLGEAFTPEVRSAWMAAYATLSDIMIASAE. 134
184 3.000e-41UniRef50_A0A1E3PJ88 Nitric oxide dioxygenase n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PJ88_9ASCO  ali  16  2SLTSTQTEIIKSSVPFLE--EKGDELAKHMYDLMFEKYPEVRPLFNKVHQKN---FTQPKILAFALLAYAKNIDNISVLGAFVNQIVSKHVGL---QILPEHYPIVAECIIQAIKDLLGDAATDDLIEAWTVAYTDLAGILIGAEEA 140
185 3.000e-41UniRef50_A0A1E3H4Z3 Bacterial hemoglobin n=1 Tax=Methylobrevis pamukkalensis TaxID=1439726 RepID=A0A1E3H4Z3_9RHIZ  ali  22  1.MTPEEIRLVQDSFREIQPS--VGVVANVFYAHLFSMTPALRPLFPH------DMSGQKIKLMKMIEAAVDNLHHFDLMRPTIRSLGARHVGYG---VRDEHYDLVGAALLHTVAAALGDGWTTDIEDAWLEVYGRVAGEMKDAA.. 133
186 3.000e-41UniRef50_Q6CB74 YALI0C21362p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6CB74_YARLI  ali  18  2.LTDAQIKIIKDSAPFLA--ENGTDFAAKMYKYMFATYPEVIRFFNQSDQKN---LAQPKILAHALVAYASNIDNLGVLSDFVEQIVVKHVGL---QIQPEQYPIVAASIIHTLKEMLGEAATPEFIEAWTVAYTQLANILIDAEK. 138
187 3.000e-41UniRef50_A0A1U7IDG3 Bacitracin resistance protein BacA n=8 Tax=root TaxID=1 RepID=A0A1U7IDG3_9NOSO  ali  21  3..SQQTIDIVKSTAPVLK--KNGQQITSRMYEIMFQNHPEIREQFNMSDQADGS---QPARLATAVYSYANQIDNLAALKSMVEKIAHRHVQ---THVTPEQYPIVGESLLQAMKDVLQEAATDEVMAAWTEAYQALSEVFINRE.. 137
188 4.000e-41UniRef50_A0A177QZV1 Hemin receptor n=1 Tax=Betaproteobacteria bacterium SCGC AG-212-J23 TaxID=1799662 RepID=A0A177QZV1_9PROT  ali  26  1.MTPEQIDLVQRTWRAVLPVGD--TAAELFYGKLFSLDPEVRRLFKN------DMVDQGRNLTAMISVAVGALAKPERIRLAVRQLGERHAAYG---VERRHFELVGVALIWTLEKCLGEAFTPDVKDAWRATYVFLTEAMLIGA.. 133
189 4.000e-41UniRef50_A0A0H4KKN4 Flavohemoprotein n=21 Tax=Bacteria TaxID=2 RepID=A0A0H4KKN4_9BACI  ali  20  2.LDPKTIEIVQSTVPVLK--EHSKEIGKRFYELLFAKEPDLYNMFNQTNQKRG---IQQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAIG---VKAEQYPVVGETLLQAVKDVLGDAATDEIIEAWGKAYGYIADAFINLEKN 139
190 5.000e-41UniRef50_A0A1L7T827 Probable flavohemoglobin n=21 Tax=Fusarium TaxID=5506 RepID=A0A1L7T827_FUSMA  ali  17  2SLTTSQVDIVKSTAPVLKI--HGETITSLFYKNLIGTYPELRNIFNLSHQHDG---AQAKALAGAVLAYATYIDKPEFLASTIERIAQRHVSL---KVTEDQYALVGEQLIKAIGEVLGDTLTDDIADSWTAAYGQLANIFINREKQ 140
191 5.000e-41UniRef50_D4XB67 Flavohemoprotein n=45 Tax=cellular organisms TaxID=131567 RepID=D4XB67_9BURK  ali  22  2.LSPEVRALVKATAPVLK--THGVALTRHFYARMFEHNPELKHVFNQGHQGGGQQQH---ALAGAVTAYAEHIDDPSVLAPVVTRIVHKHVSLG---IRAEHYAIVGKHLLASIREVLGEAATDELVDAWAAAYGQLADLLIAEE.. 137
192 5.000e-41UniRef50_UPI00068661E2 hypothetical protein n=2 Tax=Planktothrix TaxID=54304 RepID=UPI00068661E2  ali  23  180..TTAQIELVETSFEKIKPR--AVEFVSSFYQNLFETYPETQRLFGKT-----DMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKGYGTIT---EYYPLVGEILLKTFADYLQEDWTPDVAQAWLEIYTNTSNLMLEGA.. 312
193 6.000e-41UniRef50_A0A2A4VZ60 Methyl-accepting chemotaxis protein n=23 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A4VZ60_9GAMM  ali  21  1.MTPKQITLVQESWQKVLPI--APQAAENFYNTLFELDPSLKPLFKS------NIVDQGNKLMTMLDTAVKLLNSPDKLIPAVQKLGARHLDYG---VKTQHYDTVGKALLNTLETGLGDEFTTPVKRAWTAIYKVLSKTMIDAANA 135
194 6.000e-41UniRef50_P04252 Bacterial hemoglobin n=146 Tax=Bacteria TaxID=2 RepID=BAHG_VITST  ali  19  2.LDQQTINIIKATVPVLK--EHGVTITTTFYKNLFAKHPEVRPLFDMGRQES---LEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAG---VAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQVE.. 137
195 6.000e-41UniRef50_A0A061H6I6 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H6I6_9BASI  ali  19  2SLTSQQVAIIQATVPVLKQ--HGEHITTTFYRHLLEENPALKNVFGMTNMLTG---RQPKALAHGLLAYASHITEPAVLADFVEKVSHKHASLG---VEPAQYAVVGKYLLAAMAEVLGDAFTPDVHDAWAAAYWILANIMIEREAQ 141
196 6.000e-41UniRef50_A0A1V9ZMC5 Nitric oxide dioxygenase (Pi-NOD1) n=5 Tax=Saprolegniaceae TaxID=4764 RepID=A0A1V9ZMC5_9STRA  ali  19  25ALSAKTIDIIKATSPVVA--EHGYAITTTMYGTMLTSDASVRALFNPSHQKGENQARQPSALAHAVSAYAANIDNLGVLTAAVERIAQKHVSL---YILPEHYDIVGSHLLRAIKTVLGDAATPEIVQAWAEAYGFLAEILIERERE 169
197 7.000e-41UniRef50_A7RGQ4 Predicted protein n=2 Tax=Actiniaria TaxID=6103 RepID=A7RGQ4_NEMVE  ali  21  30.LSTRRKKLVRESWELIEPVK--ITIGKRLFTRLFDVNPNMQDTFPNFKLNSRSLYLHAKRVMVAVENAVTVLDDAETFESYLINLGGRHLPWG---VTKDHFGVVGEAFIWALQDVLGEGCTSDVAEAWIDLYGYIVQAMLEGLQQ 177
198 8.000e-41UniRef50_I8IYL2 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=2 Tax=Fictibacillus TaxID=1329200 RepID=I8IYL2_9BACI  ali  21  2.LTQETMKVIKATAPVL--QEHGVAITTVFYEELFREHPELRNVFNQSNQAQG---RQQVALAQILYQAALHIEQLETLLPAVRQVGEKHRSLG---VVPEHYPIVGKHLLLAMKAVLKEAATDEILEAWETAYEVIASLFIEQEQ. 138
199 1.000e-40UniRef50_A0A1C3EJG9 Flavohemoprotein n=3 Tax=Planctopirus TaxID=1649480 RepID=A0A1C3EJG9_9PLAN  ali  22  2.LSSATLSVVRATAPALA--EHAQSITKRFYQLMLSEHPELWAYFNPAHQQSG---RQSMALANAIVAYATHIENLGVLLPAVELIAQKHCSLG---VQPEHYPIVGKYLLRAIRDVLGEAATDDVLTAWGEAYQLLADLLIERE.. 137
200 1.000e-40UniRef50_A0A254TKT7 Sugar (And other) transporter family protein n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A254TKT7_ASPNG  ali  22  46.LTPEQIKIIKATVPVL--QEYGTKITTAFYKNMLTAHPELNAVFNTANQVNG---HQARALAGALFAYASHIDDLGALGPAVELICNKHASL---YIQADEYKIVGKYLLEAMKEVLGDACTDDILDAWGAAYWALADIMINRE.. 181
201 1.000e-40UniRef50_A0A2J0YT24 Nitric oxide dioxygenase (Fragment) n=1 Tax=Rhizobium meliloti TaxID=382 RepID=A0A2J0YT24_RHIML  ali  19  1............................HFYKRMFQAHPELKNIFNMAHQERGE---QQQALARAVYAYAANIENPESLSAVLKDIAHKHASLG---VRPEQYPIVGEHLLASIKEVLGDAATDEIISAWAQAYGNLAD-ILAGMES 112
202 1.000e-40UniRef50_D0MR65 Nitric oxide dioxygenase (Pi-NOD1) n=15 Tax=Peronosporaceae TaxID=4777 RepID=D0MR65_PHYIT  ali  19  22.MSAKTIAILKATAPVV--QEHGTEITSTMYGTMFSEFPEVQNLFNMSHHAPPGVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVSL---DIRAKHYPIVGGCLLRAIKTVLGDAATDEIIDAWKEAYWFLADLLIQAEDN 171
203 1.000e-40UniRef50_UPI00037A7EB7 flavohemoprotein n=2 Tax=Thiotrichales TaxID=72273 RepID=UPI00037A7EB7  ali  19  3..TAESLAIVQATVGVVR--EYGADITRKFYSTLFAAHPELTNLFNMSNQASGE---QQQALASAVYAYAANIQNPTALEPILSRIAHKHASLG---IKPAQYTLVGKHLLAAIKSVLGEAATPEILAAWDEAYWLLACELVARE.. 137
204 1.000e-40UniRef50_A0A1M5K8Q5 Hemoglobin-like flavoprotein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1M5K8Q5_9GAMM  ali  27  1.MNEQLIQDVQGSWVAVEGI--APQAAALFYRNLFEADPALQALFK------GDMVAQGARLMQMIGVAVSKLRDIDALVPVLQALGRRHVTYG---VQDAHYAVVGAALLKTLGQGLGPAFTPQVQASWTAVYGAISDVMIEAA.. 133
205 1.000e-40UniRef50_A0A1L6LXQ4 Putative bacterial hemeoglobin n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LXQ4_9DELT  ali  18  13SFDEGRAALLRVSFQRLLPMADL--VAELFYGRLFLLDPSLRALF------RGDMKSQGRKLMSVLQVAVNNVDRVETILPVVQGLGRRHVGYG---VRDEHYETVRSALIWTLQQGLGDDLTPATAAAWADMYDMIASVMRGASRE 148
206 1.000e-40UniRef50_A0A1A9NPZ4 Hemin receptor n=3 Tax=Methylophilaceae TaxID=32011 RepID=A0A1A9NPZ4_9PROT  ali  21  1.MTPQQISVVKKTWALAEPLGD--TVTVLFYGRLFELDPSLRSLF------RKDMQEQGRSLRTMIGMVVGGLDDPDKLAGALAASGRRHVTY---RVENRHYDTVREALLWTLNQALREIYTAEVRDAWIATYNMMADTMKAAAAE 135
207 1.000e-40UniRef50_A0A1Z4ISC4 Uncharacterized protein n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A1Z4ISC4_9CYAN  ali  18  1.MSSLNVKLLEKSFAGIKPY--ATQFASRFYYNLFTDNPQLEPLF-----ANTNMQEQDKKLMMTLVLVIYNLRNFAYLKTILRDLGERHVRYATI---EEHYPMVGTALLKTFEFYLGTDWTPEVKQAWTDAYAEIVNIMLEGTKS 136
208 2.000e-40UniRef50_A0A0A1Z321 Flavohemoprotein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0A1Z321_PSEFL  ali  19  3..TSQQRALVKATVPLLETG--GEALTRHFYAMMLSEYPEVRPLFNQAHQASGD---QQRALANGILMYAKHLDHLEALGPLAGKIVNKHVSL---QILPEHYPIVGTCLLRAIREVLGADATDEVLEAWGVAYGILADLLINAEE. 139
209 2.000e-40UniRef50_I1XFU2 Flavohemoprotein (Nitric oxide dioxygenase) n=1 Tax=Methylophaga nitratireducenticrescens TaxID=754476 RepID=I1XFU2_METNJ  ali  17  1.MKPETFDIIRQTVPVLEQ--HGELLADCFYKNMFHNNPEVKAFFNPAHQHSG---AQQRALAATICAYARHIENFDQLQQLIGLISQKHVSFG---IKPEHYPIVENHFLLALREVMGESATEEVIEAWTEAYGVLAGIFIDKEDD 138
210 2.000e-40UniRef50_UPI00084ADFC8 uncharacterized protein LOC108680782 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084ADFC8  ali  20  354.LTQEQKIIIKETWAIVKQ--NVERVGVIMFTNLFETHPDVQEVFKNALLDNKKLRNHALRVMGFVEKAVGRLEEPAQLQALLETCGRNHCGYGAAL---HHIDLVGPQLLEAIKPSLEDRWSPEISTAWTLLMDNIAYAMKAAMR. 500
211 2.000e-40UniRef50_A0A2G3K510 Hemin receptor n=1 Tax=Chitinimonas sp. BJB300 TaxID=1559339 RepID=A0A2G3K510_9BURK  ali  27  1.MNAETIKLTQESWKKVAAIAPQAA--ALFYENLFTADASLKPMFK------GNMEEQGQKLMQMIGAAVSKLNNQETLIPILQALAKRHAGYG---VKPSHYQTVGAALIQTLEQGLGNDFTPAVKAAWVEVYGAMVGVMVSA... 132
212 2.000e-40UniRef50_A0A2A5HE23 Flavohemoprotein n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HE23_9ALTE  ali  18  10.........IKASVPVLR--EHGLTITTLFYKNMFAAHPELKHLFSRSSQAGG---AQQQALAGAVYAYADNIEKPEFLSSVLNRIAHKHASLG---IKPAQYTIVGKYLLGAIAQTLGDGATPELLDAWDEAYWLLAGELI-AMEA 138
213 2.000e-40UniRef50_A0A0B6ANF3 Flavohemoprotein n=38 Tax=Bacillales TaxID=1385 RepID=A0A0B6ANF3_BACMB  ali  20  2.LDSKTIEIVQSTVPVLK--EHSKQIGKRFYELLFEKAPDLYNMFNQTNQKRG---IQQEALGYAVYAAGEHITNLEAIKPVIERISQKHRAIG---VKAEQYPVVGETLLQAVKDVLGDTASDEIIEAWGKAYGYIANAFIELEEA 139
214 2.000e-40UniRef50_A0A1H5ZWH9 Nitric oxide dioxygenase n=6 Tax=Bosea TaxID=169215 RepID=A0A1H5ZWH9_9BRAD  ali  23  1.MTPHQTQLIRESFAHLHRRQ--AESAELFYGRLFEIAPETRALFK------TDIRSQGVKLMESLTVAIASLNDRPGLTAFLKKLGRNHRNYG---VEAKHYASVGEALIWTLQTSMGKEFTDETRLAWEILYGDISGVMIKAQEA 135
215 2.000e-40UniRef50_I2K714 Nitric oxide dioxygenase n=2 Tax=Proteobacteria TaxID=1224 RepID=I2K714_9PROT  ali  20  2SLSQSTITTVKATAGAVSQ--HAEAITTKMYEILFSQHPELKELFK---DADPD---QHKKLASAVGAYAANIDNLDVLSKAVEKMAQSHVR---THVKPEHYPMVGTAILGAIKEVLGDAATDEILDAWKEAYFFLADILIAREKE 137
216 2.000e-40UniRef50_UPI000DABA6F9 NO-inducible flavohemoprotein n=1 Tax=Thermosporothrix hazakensis TaxID=644383 RepID=UPI000DABA6F9  ali  19  2ALQREEIQLVASLVPVLKA--HGSEITTRFYNMMFTAHPELLNIFNHSNQRDG---LQQQALASSVYAAAAHIDNLDAIEPVVQHIAHKHCSL---NVQPEHYPIVGKYLTLALKDVLGNAVTPEVERVWLKAYDVIADYFIRMEQD 140
217 2.000e-40UniRef50_UPI000BAF0685 non-symbiotic hemoglobin 1-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAF0685  ali  20  37.FTEDQKQLVKATWDVVR--EDISKVGVITFLRLFEKFPDVQDLFVPFRGLNSELREHGLRVMGTIEKCITRIDKPEKLTSMLEVLGEKHIVFDT---KIEYFDLLTPQLIQAIKPAIGDQWTPEVEHAWNNFLFYITGIMKNAM.. 182
218 2.000e-40UniRef50_G2XJ88 Hemoglobin n=2 Tax=Verticillium dahliae TaxID=27337 RepID=G2XJ88_VERDV  ali  20  4..TEAQTAIVKSTAPILK--EHSLTITTVFYKSMLGAHPELHNIFNISNQRSG---AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLG---ITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFVKRE.. 138
219 2.000e-40UniRef50_I0IMI4 Putative flavohemoprotein n=31 Tax=root TaxID=1 RepID=I0IMI4_LEPFC  ali  18  6.......DLIKASAQLIAPL--GSKVTEYFYNTMFTDHPEVRKMFPA------EMGVQAQRLFDSIVYITSNIDKPDALVPYLQRLGSGHIKFDT---RPEHYPIVGNSLMKTLAHFAGPAWTKEMAEAWSEAYNLAASVMIEAA.. 132
220 2.000e-40UniRef50_A0A250IQZ8 Nitric oxide dioxygenase n=2 Tax=Melittangium TaxID=44 RepID=A0A250IQZ8_9DELT  ali  19  6.LAPRTIEIIQSTVPVLKV--HGEAITTRFYQRLFESHPELRDVFNQARQREGK---QQAALANAVYAAAQNIERLEAILPAVRNIAHKHRALG---VVPEHYPIVGQHLLAAIKEVLGDAATGEILGAWAEAYQEIASVFISVERE 143
221 3.000e-40UniRef50_A0A060T0W4 ARAD1C11660p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T0W4_BLAAD  ali  18  2SLTKDQVDIIKATVPVLETR--GEEITKYFYSKMLSENPDVSNFFNKTHQAS---FAQPRALAHSLLAYAHNIDNLDALSGLVERVAQKHCSL---MVQPEHYPIVGKYLLIALSDVLGDVATEAVLEAWGAAYQALANILIEAE.. 139
222 3.000e-40UniRef50_A0A1H0HXP3 Nitric oxide dioxygenase n=2 Tax=Bacillus TaxID=55087 RepID=A0A1H0HXP3_9BACI  ali  16  2.LTQDQISTIKATIPVLE--EHGVTVTTHFYKTLFEDYPQLLNLFNHVNQDTG---AQPKALAYSLYQAAVHIDRLEAILPVVHQIAHKHRSIG---VKEEHYPIVGEYLLKAMQEKLDLSADDPIIEAWGATYEIVADVFIQVEKE 139
223 3.000e-40UniRef50_A0A0P7CHQ3 Hemin transporter n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0P7CHQ3_9ACTN  ali  20  2.LSIESAAVVRATAPVVAA--HSVEITSAFYPRLFSAHPELLRLFNQGNQANGD---QRRALAASVVAYATQLIDPQAFQPVLERIAHKHASLG---VLPEQYTVVGRNLLAAVGDVLGDAVTPEIAAAWDEVYWLFACQLIAEE.. 139
224 3.000e-40UniRef50_A0A2E7E671 Uncharacterized protein n=1 Tax=Oceanospirillaceae bacterium TaxID=1899355 RepID=A0A2E7E671_9GAMM  ali  19  16.LSPATLEIVAATVEVVRA--NGTAITDVFYRNMLSAYPELQRLFNMPNQASG---GQKQALASAVYAYAANQNNPEALEPVLNRIAHKHASLG---ITPAQYTIVGKYLLGAVADVLGDAITPEVAAAWDEVYWQLACDLIARE.. 151
225 3.000e-40UniRef50_A0A0G4MVX5 Uncharacterized protein n=4 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4MVX5_9PEZI  ali  20 1185..TEAQTAIVKSTAPILK--EHSLTITTVFYKSMLGAHPELHNIFNISNQRSG---AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLG---ITPDQYAIVGEHLIKAIATVLGDGLTPEVADAWVAAYGQLADIFVKRE.. 1319
226 4.000e-40UniRef50_UPI0009E48129 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E48129  ali  19  9GLTDLQIEMIRSSWEKVTPNKK--HHGQLLFHKLFEIAPEMTDLFPFGDDTKPQFTTHALNIMNALDHAIQNLDNPDVLIPKLRELGQMHAGF-ELTIKE--FQHVGEALIWVLATGLGDDFTPQLRTAWGDVYAIITDVMLGAIKD 151
227 4.000e-40UniRef50_A1ZE02 Flavohemoprotein n=1 Tax=Microscilla marina ATCC 23134 TaxID=313606 RepID=A1ZE02_9BACT  ali  18  3..SKENIAIVKSTVPVLETQIH--TITQAFYKRLFKNHPQLKEVFNMTHQAKGS---QPKALATAIFQYARYIEQPEVLKAAIAMIAEKHVSL---SVTPTQYEVVGENLLAAIKEVLGDAATPEVLGAWAEAYGQLAQLLIGEEE. 138
228 4.000e-40UniRef50_UPI0008247F59 NO-inducible flavohemoprotein n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI0008247F59  ali  21  18.LDPEKLEIVKATLPVV--LEHGEAITTRFYERLFENHPELKNVFNLTHQKTG---HQPKALANAVYAAAANIEDMSAIMPALERIGQKHRSL---QIKPEQYPIVGENLLGAIKEILGEAATPEIIDAWADAYTIIADVFIK.... 151
229 4.000e-40UniRef50_D3D7N7 Transcriptional regulator, ArsR family n=5 Tax=Frankia TaxID=1854 RepID=D3D7N7_9ACTN  ali  19  322.LSIESAAVVRATAPVVAA--HSVEITSAFYPRLFTAHPELLRLFNQGNQANGD---QRRALAASVVAYATQLIDPQAFQPVLERIAHKHASLG---VLPEQYTIVGRNLLAAVGDVLGDAVTPEIAAAWDEVYWLFACQLIAEE.. 459
230 5.000e-40UniRef50_B3RYV6 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3RYV6_TRIAD  ali  24  16SLTEEQKAIIRENWQDVE--ENMSEVGLYLFSKLFTIAPEYREVFPFTTTDNVRLRVHATGVMKTVGKAVQNLDQFSELQSALSTLGQFHHR---KAIKFENFQAVGQALIQTLSDKLQENFTPEVHEAWSKTFDMITAAMKSGM.. 156
231 5.000e-40UniRef50_A0A2A4N209 Nitric oxide dioxygenase (Fragment) n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4N209_9GAMM  ali  23  2.LSQQTIETVQSTIPLLA--EHGQTITQNFYEKLFVAHPELKNVFNLNNQQDGN---QARALADAVFAYANNLTNLEALIPAVQRIANKHVSLG---IKPEQYPIVGQYLLAAIQDVLSLPDDHPALTAWAEAYAVLADVFINTEE. 138
232 5.000e-40UniRef50_A0A2A3I599 Hemoglobin-like flavoprotein n=1 Tax=Streptomyces sp. TLI_235 TaxID=1938860 RepID=A0A2A3I599_9ACTN  ali  27  7........LVKSSFAAVEP--HGTEVTAWFYRHLFEHHPAVRPLF------AEHLDEQQDRLFAALGALVANLEDTDTLVGVLTGLGRRHAGYGAL---PEHFPAVGVSLIATLRHFAGDAWSPQAEAAWAAVYGVVADTMGRAL.. 132
233 5.000e-40UniRef50_A0A1I3GIY1 Nitric oxide dioxygenase n=4 Tax=Bacteria TaxID=2 RepID=A0A1I3GIY1_9RHOB  ali  24  2GLDDEQIAAIRGSWAPVYAARDLA--AGLFYGRLFQIAPESRALF------SGDPTEQGRKLTETLAYVIEALDRPEALVEPVEALARRHVDYG---VRPEDYAAVGRALIWMLERHLGGGFTPQARLAWVAAYDHLARRMIAAA.. 135
234 5.000e-40UniRef50_I0JWG1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum fumariolicum (strain SolV) TaxID=1156937 RepID=I  ali  20  1.MTQERIKLIQKSW--LYVMDKADEAGRLFYKRLFEVEPNVRSLFK------ENIEKQGKKLIDVINWIVLNLQDIDTVFGGAKELARRHVRYG---VQVEHYPLVGHTLIWTLGNIIGKEWTKELEQAWTEAYEALSQVMIEEHK. 134
235 5.000e-40UniRef50_UPI000568E4F5 hypothetical protein n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=UPI000568E4F5  ali  21  4...DTQISLVKKSWESAYKIQDVA--GPLFYNRLFEIAPEVRYMF-----AQTNLQEQSKKLFQMLNYIIQRLHNLDDIIDEVASLAGRHVKYG---VKERHYQIVGEALLWTLEKGLGELWNSETKESWVKTYTILSSAMIGASR. 136
236 5.000e-40UniRef50_C7PYV8 Oxidoreductase FAD/NAD(P)-binding domain protein n=3 Tax=Catenulisporales TaxID=414714 RepID=C7PYV8_CATAD  ali  23  5........LLRTSWAKVAQY--GEQVPLFFYGHLFLSHPEVRAMFP------PSMAAQRDRLVAALGAVVANVDNLDSAVPFLQGLGRDHRKF---AVEPGHYPAVGASLLATLEQFLGPDWTPAVAESWTEAYGIVAKVMTDAA.. 130
237 5.000e-40UniRef50_Q5QSA9 Globin X n=11 Tax=Euteleostomi TaxID=117571 RepID=Q5QSA9_DANRE  ali  18  27GLTTNHIRLIKESWRLI--QEDIAKVGIIMFVRLFETHPECKDVFFLFRDTSRELRAHGLRVMSFIEKSVARLDQLERLETLALELGKSHYRYNAP---PKYYGYVGAEFICAVRPILKDRWTPELEEAWKTLFQYVTSIMREGF.. 174
238 6.000e-40UniRef50_Q8ZCR0 Flavohemoprotein n=995 Tax=root TaxID=1 RepID=HMP_YERPE  ali  20  2.LDTQTIAIVKSTIPLLAAT--GPKLTAHFYERMFKHHPELKNIFNMSNQSSGD---QREALFNAICAYATNIENLAALLPTVERIAQKHTSL---NIQPEHYPIVGEHLIATLDEL----FSPAVLDAWAKAYGVLADVFIQRE.. 135
239 6.000e-40UniRef50_A0A2U1VPX2 Uncharacterized protein n=1 Tax=Azospirillum sp. TSO22-1 TaxID=716789 RepID=A0A2U1VPX2_9PROT  ali  27  1.MSPDDMETVRRSFCKVAMLN--ARVGLQFYERLFALDPDLRALFG------EDVHPQAEKLVATLASAVRHLSNPAALEGSLRAMGERHRGYG---VRDEHYATVGEALLSTLETNLGPEFTPDVRGAWLALYGMVARMMR..... 130
240 6.000e-40UniRef50_A0A285EXK6 Ferredoxin-NADP reductase n=4 Tax=Micromonosporaceae TaxID=28056 RepID=A0A285EXK6_9ACTN  ali  25  1........MLKESWSLIE--EHQEKVAGYFYARMFLSHPELRDLFPV------HMDMQRSRLLGAIVTAVQTLEDPEKFDSYLRGLGRDHRKF---HVEPEHYEVVGGALIEAMRQYAGESWSVEYDQAWADAYAVIASKMLSGAEA 128
241 6.000e-40UniRef50_Q5FSL1 Flavohemoprotein n=30 Tax=Gluconobacter TaxID=441 RepID=Q5FSL1_GLUOX  ali  17  8SLTPETIAIIKATIPALEA--HGVTITSEMYRRLLA-DPAIAEMFDPTHQSTG---TQPRALAMAVLAYAKNIDNLGVMGSAVERIAQKHASL---EIQPEHYPHVATALLGAISSVLGEAATPEILDAWGKAYWALADILIGRE.. 143
242 7.000e-40UniRef50_A0A1A9HJM4 Dihydropteridine reductase n=2 Tax=Mitsuaria TaxID=65047 RepID=A0A1A9HJM4_9BURK  ali  18  4...PQTIALIQATVPLLKSR--GEDITRHFYRAMLTGHPELKAFFNEAHQAEG---TQARALAGAVLAYASHIDRIHEIAPALPRIIQKHVALG---VQPEHYPIVGACLLAAIREVLGDVATDEIIAAWAEAYGALAQLLIDAEEQ 140
243 7.000e-40UniRef50_UPI000CF1EB88 hypothetical protein n=3 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000CF1EB88  ali  23  72........LIKSSYGVVEP--HGTEVTAWFYRHLFEHNPGVRSLF------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAAYGAL---PAHLPAVGASLLATLAHFAGPAWTPETERAWTAVYGVAAETIGAAM.. 197
244 7.000e-40UniRef50_A0A0Q1CSX6 Uncharacterized protein n=17 Tax=Burkholderiales TaxID=80840 RepID=A0A0Q1CSX6_9BURK  ali  29  1.MSPEQIHLVRQSFAQVAPV--AAKAGALFYAKLFARDPAISGLF-----ASSDMNEQARKLLDMIGSAVRMLGQPEQLDAALRALGKRHAGYG---VEAAHYDTVGAALLDTLAEALGGAFNPATREAWGALYAHVGTTMRAGA.. 134
245 7.000e-40UniRef50_W1DIL4 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=3 Tax=Enterobacterales TaxID=91347 RepID=W1  ali  18  2.LDAQTIATVKATIPLL--VETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD---QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSF---QIKPEQYNIVGSHLLATLDEM----FSPEVLDAWGKAYGVLANVFIGREAE 137
246 7.000e-40UniRef50_A0A1M3HDM8 Uncharacterized protein n=2 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HDM8_9SPHI  ali  22  1.MTLRQIELVRYSWARVTAI-DEVTFGIGFYNRLFEIAPEIEPMFKRP------ILEQSRKLTTILDHVIEKLDALDDIVENIVKLAHRHENYG---VKPEHYTLVGEALLWTLERELGDLWNDELKFAWTMCYVGISTAMLQAMK. 135
247 8.000e-40UniRef50_K0RES8 Vesicle transport protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RES8_THAOC  ali  22  149ALFARRKGAIQTTWVAVGDSL-GIEATRLFYERLFDQHPEVKPMFS----DPDDMEEQAAKLLKTISVAVESLSDIATLVPILQDLGKKHAE--KWNVQRNHYDAVGECLIWTLKTGLGDSWTEDVADAWSWVYGVIAKTMGDAGQE 288
248 8.000e-40UniRef50_UPI000719D0AA neuroglobin-like n=3 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719D0AA  ali  22  19.LTEREKALIRRSWKLLCEDS-MTMIGGEIFLKIFELNNEVKALFPFRDKHDPDFKGHASRFMQALGAAVDNLDNLHSLEPLLSALGKTHTRYTDRGFTPAFFDEFTASILHVWRERLGRKFTPEVRAAWLAMVSFIATAMKDGYR. 169
249 9.000e-40UniRef50_A0A142BGA4 Flavohemoprotein n=3 Tax=Endozoicomonas TaxID=305899 RepID=A0A142BGA4_9GAMM  ali  21  2NLSAETVQTVKATVPVLE--EHGVAIVEYFYKDMLSENPELLNVFNAANQRSG---RQQAALTGAIYAYAANIDNLDALTSTVQRIAYKHVSF---NILPEHYGIVGRHLIKAMAHVLGDKASSRILDAWSEAYNYLASLFIDVEK. 139
250 9.000e-40UniRef50_A0A1N6R640 Nitric oxide dioxygenase n=1 Tax=Chryseobacterium sp. RU37D TaxID=1907397 RepID=A0A1N6R640_9FLAO  ali  19  1.MNTNQKNLIKATIPFLK--TNGTDLTKHFYATMLSENPELNNLFNISNQASG---RQQNVLANTVLAYAENIEKPTVLINILKGIGNKHVSL---NIHPEQYKIVGHYLISSIKAILGDAATAEIIEAWTEAYNELAQIMIS.... 134
251 9.000e-40UniRef50_A0A0J9XEW3 Similar to Saccharomyces cerevisiae YGR234W YHB1 Nitric oxide oxidoreductase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0  ali  18  3.LTPDQISVIKATIPVLK--EGGVTLTTKFYENMLNEKPEVRPFFNPAHQASG---MQPKALAHSLLLYATYIDDLGKLSDLVERIVSKHVTL---LIQPDQYPIVGEYLIRTMKEVLGDLATDEVIGAWTAAYGDLANLLIDLEE. 139
252 9.000e-40UniRef50_A0A1H3U9P0 Nitric oxide dioxygenase n=2 Tax=Jannaschia faecimaris TaxID=1244108 RepID=A0A1H3U9P0_9RHOB  ali  20  14.LTPRQIFLIRDSFSSVAPMRK--TAATLFHAHLFEMAPSVRPLFSR------DVSDQGDMLMAALARIVRALDRMEDVAPDLEALARRHPGYGA---REEHYPAVGEALIWALEQALAERFTDEVRKAWVDAYAEISHIMIAATRA 148
253 1.000e-39UniRef50_A0A1W1USN6 Hemoglobin-like flavoprotein n=6 Tax=Bacteria TaxID=2 RepID=A0A1W1USN6_9DEIO  ali  20  1.MTDDQIQLVQHSFTFIETQ--AEFVAARFYERLFALDPALKALF------RGDLAEQGRKLMSALRLVVRGLDHLPPLLPAVRELGARHASFG---VQHTHYALVGTALLGTLNEVLGDAFTTETREAWLEAYETLATVM...... 129
254 1.000e-39UniRef50_V8QYU3 Dihydropteridine reductase n=33 Tax=Proteobacteria TaxID=1224 RepID=V8QYU3_9BURK  ali  17  8SLSPETVAIVKATVPAL--QTHGSAITAKMYDRLFRDE-HIRSLFNHANQANGK---QINALAGAILAYASNIDNLGALLPAVERIAQKHVGF---HILPEHYPYVATALLGAIGDVLGEAATEDILNAWGEAYWFLAGILQNRE.. 143
255 1.000e-39UniRef50_F3MBR1 Flavohemoprotein (Fragment) n=3 Tax=Bacillales TaxID=1385 RepID=F3MBR1_9BACL  ali  25  2.LSQRTIEVVKSTVPVLE--THGTAITSAFYQKLFHHHPELLNIFNHANQREGK---QPFALANAVYAAAAHIDRLEAIVPVVKQIGHKHRAL---NILPEHYPIVGETLLGAMKDVLGDAATPEIIEAWAEAYGVIADVFI..... 134
256 1.000e-39UniRef50_A9AW41 Globin n=1 Tax=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) TaxID=316274 RepID=A9AW41_HERA2  ali  22  2..........QQTFAEV--GRNPQQLVEAFYGQLFMLAPDFRPLFP------EDMSEQKKKLLQSLVLVVNNLKKPEAVLPAVQELGRRHVDYG---VKPEHYQTVGAALIWALSQQLGEQWNDEVQAAWVAAYTLVANVMVEASQA 127
257 1.000e-39UniRef50_UPI00034B7A69 hypothetical protein n=1 Tax=Prochlorothrix hollandica TaxID=1223 RepID=UPI00034B7A69  ali  18  4.....QVELLEQSFEKVKPQ--ATEFVDRFYENLFADYPAAKPLFEHTN-----MAKQKTMLLNSLVLVVDNLRSPDVLSDALKGMGARHVNYGAL---PAHYPLVGNSLIKTFSQFLGDGWTSDYEAAWAGAYDVITDLMLQGAD. 134
258 1.000e-39UniRef50_I1RB58 Uncharacterized protein n=34 Tax=Sordariomycetes TaxID=147550 RepID=I1RB58_GIBZE  ali  20  2ALSYQQTKLIRGTIPAL--TDHGERITTIFYRNMLRDHPELNDYFNTVNQANG---RQPRALTAVILSYANNINHITELIPKMERMCHKHCSLG---IKPEHYAIVEKYLIAAFAEVLGPTMTTQIREAWTKAYWMLAKMLIGREAQ 140
259 1.000e-39UniRef50_UPI000DCD8962 hemin receptor n=1 Tax=Chryseolinea sp. SDU1-6 TaxID=2059302 RepID=UPI000DCD8962  ali  22  1.MTERQILLVKNSWSYV--IVKSEEAGQLFYHRLFEIAPELKSLFKS------EPKGQSRKLINMVTLMVSKLQKLDEIQGEIKSLATRHHKYG---VDPAYYRIVGAAFLWTLQQGLKDKWNEELEEAWVDMYAVISNAMIK.... 131
260 1.000e-39UniRef50_B3DUZ1 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=3 Tax=Methylacidiphilum TaxID=511745 RepID=B3DUZ1_METI4  ali  18  1.MTREEIKMIQKSW--LRVIDKMDEAGLLFYRRLFDVEPKVRPLFKI------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYG---VKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEEHK. 134
261 1.000e-39UniRef50_A0A2N3UWU4 NAD(P)H-flavin reductase n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3UWU4_9ACTN  ali  17  1.MTEDQLTLIRSSFALLR--DHGDKLAAHFYATLFLHNPQLRELFPAA------MDVQRDRLFQALAGAVRMLDRPAELTVFLQQLGRDHRKYG---VRSEHYAAVGQALLATLARFAGPQWTPAHERAWTIAYHQIAATMSGAAE. 135
262 1.000e-39UniRef50_Q87F90 Flavohemoprotein n=49 Tax=Proteobacteria TaxID=1224 RepID=HMP_XYLFT  ali  18  4SFSPHTITLIKSTVPLLA--EHGTTIIEAMYHRLFE-DPQIEALFNQANQKNG---TQIHALAGAILAYARNIDNPGVLASAIERISQKHVGY---AIHPEHYPHVATALLGAIKQVLGDVATSEVLEAWGEAYWFIANLLKDRE.. 139
263 1.000e-39UniRef50_A0A0D6MNJ7 Oxidoreductase FAD-binding domain-containing protein n=1 Tax=Tanticharoenia sakaeratensis NBRC 103193 TaxID=1231623 RepID=A0A0D6M  ali  17  5.LDENTRSIIKACIPALEV--HGLAITTEMYRRLL-IDPDIRSYFNLSHQADGS---QARALAGAVLAYARHIDDPGVLGAAIERIAEKHVGL---TVQPGHYPLVGTAFLGAIGEVLGDAATPEILEAWGHAYWFLADILIAREAE 141
264 2.000e-39UniRef50_UPI0009E1D017 globin-1-like isoform X1 n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E1D017  ali  26  83.LTPAQKYLVRETWETIELHKNS--VGKKTFLRFFEKNPEYQKLFPEFKDVPPELYGHTKRVMKAVENAVSALDDAESFSAYLDELGRRHK---TRSLRPTHLEAMQDALMFTLQDLLKSSWTDETSDAWKKLFHFIIDHMIYGLQS 230
265 2.000e-39UniRef50_A0A210QE49 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210QE49_MIZYE  ali  24  8.LSSGDKILIKQSWSQFTSTGSLADVGVPMFAKLFADYPDVKTLFSFMREGGGSLRNHAEGVMGVVGTAVESIDNLEGLVPTVRSLGAKHYTYGA---QTAHLGPVGECLLYAMEKKLKEKFTNETKLAWLKLYDVISVAFQDGLEE 155
266 2.000e-39UniRef50_A0A1D7UZS6 Hemin receptor n=5 Tax=Leptospira TaxID=171 RepID=A0A1D7UZS6_9LEPT  ali  22  2ALGNEEIELVRASFEKVYTNKD--EVAALFYSKLFELEPSYKSLFK------GDMNEQGRKLMLMLRTLVSGLGDLANLVPVIQDMGKRHVKYG---VQSKDYDVVGAALLATLQQGLGAEFTPKLRGLWTDIYQIVAKTAIEGSQQ 137
267 2.000e-39UniRef50_A0A235HP54 Globin n=2 Tax=Cyanobacteria TaxID=1117 RepID=A0A235HP54_9NOSO  ali  22  5......VELLEQSFEKVKPRAD--EFAASFYNNLFQAHPEMKPLF-----AKTDMKNQEKKLLSSLVLVVENLRNPEALEPVLKALGARHVGYGAI---PKYYGLVVEALLVTLEQYLQQYWTPEVKKAWLDAFRAITGLMLKGA.. 133
268 2.000e-39UniRef50_A0A2C6Y0J1 NO-inducible flavohemoprotein (Fragment) n=1 Tax=Roseomonas rhizosphaerae TaxID=1335062 RepID=A0A2C6Y0J1_9PROT  ali  16  5.LSEQTIAVVKATVPALEV--HGLALTRRMYERLFQNA-SIRDLFNQSH--HGETGSQPKALAGAVLAYAQNIDNLGVLAGAVERIAQKHVGL---NILPEHYPHVADALLGAIRDTLGEAATPEILAAWGEAYWFLADLLIGRE.. 140
269 2.000e-39UniRef50_A0A2H5B1V1 Uncharacterized protein n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1V1_9ACTN  ali  23  7........LIKSSYGVVEP--HGTEVTAWFYRHLFEHNPGVRSLF------AAHLDEQQDRLWAAIGALVTHLEDPDALLPLLRGLGERHAAYGAL---PAHLPAVGASLLATLAHFAGPAWTPETERAWTAVYGVAAETIGAAM.. 132
270 2.000e-39UniRef50_A0A0M6YRD6 Soluble cytochrome O n=1 Tax=Labrenzia alba TaxID=311410 RepID=A0A0M6YRD6_9RHOB  ali  18  1.MNRREIKIVQETFG--KAATLGDKVPEIFYQELFAIDPTLKKMF------RGNMKSQGRKLLTALTMVVNNLEHTDVIVPAAEKLAVKHIDYG---VTERHYTFVGNALLRTLKKGLGDEFTPEVRNAWISAYQLLADVMRAAA.. 133
271 2.000e-39UniRef50_A0A2G2G493 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2G2G493_9PROT  ali  17  1.MTQNTMEIIKATAPVIK--EHGEAITTAMYKLLFEAHPEAKELFKDAEPD------QYKKLAAMVYAYAANIDNLGALGKGVEKVANLHVN---VNIEPKHYPWVGQALLGAIQEVLGEAATPEIMNAWKEAYFFLADVFINKEKE 135
272 2.000e-39UniRef50_A4XYB2 Flavohemoprotein n=837 Tax=cellular organisms TaxID=131567 RepID=A4XYB2_PSEMY  ali  20  2.LSHAQRDLIKATVPLLESG--GEALTTHFYRMMLSEYPEVRPLFNQAHQASGD---QPRALANGVLMYARHIDRLEALGPLVAQIVNKHVSL---QILPEHYPIVGTCLLRAIREVLGAEATDAVIEAWAVAYQQLADILIGAEES 140
273 2.000e-39UniRef50_UPI000DD441CC hemin receptor n=1 Tax=Piscinibacter caeni TaxID=1861917 RepID=UPI000DD441CC  ali  22  1.MTPQQTQLIRASHARLAP--HADRAGQLFYRKLFALAPDLQPLF------IGDIRQQATRLMQMIGAAVGLLDRPAQLVPVLQHLGARHAGYG---VQARDYHAVGLALLETLAEQLGAEFDADTRAAWSAMYALVSATMIAAARA 135
274 2.000e-39UniRef50_W0RNE9 Globin n=1 Tax=Gemmatirosa kalamazoonesis TaxID=861299 RepID=W0RNE9_9BACT  ali  25  1.MTPEHAQLVRSTWPAVAADVDALA--SRFYRHLFELDGAAAGLF-----ATVDMTAQRAKLARTLGVIVATLDDPDALLPVIGALGKRHVGYG---VEQRHYDTVGDALLWALRDTLGTAFTPEVHDAWAEAYTLVASVMRRAL.. 134
275 3.000e-39UniRef50_A0A225VFI1 Nitric oxide dioxygenase (Pi-NOD1) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225VFI1_9STRA  ali  18  21.MSAKTISILKATAPVVK--EHGTEITSTMYGMMFSEFPEVQNLFNMSHHAPSGVSRQATALANAVIGFAANCDQLGNLGDAVPRMVHKHVSL---DIRAKHYPIVGGCLLRAIKIVLGDAATDEIIDAWKEAYWFLADLLIQAED. 169
276 3.000e-39UniRef50_A0A2E0L7P3 Hemin receptor n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L7P3_9CHLR  ali  23  4..TQIQIRLVRRSFGRAATKKRL--IAALFYDRLFELDPALRPMFK------GDMEEQGRKFMRMLALIVSHLDNPDQLKTKLQSSNQRHTTIG---VRPEHYETVGAALLWALEMGLGKEFTPAMREAWLTAYEIIAQL....... 130
277 3.000e-39UniRef50_A0A1H0PYW0 NAD(P)H-flavin reductase n=6 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1H0PYW0_9PSEU  ali  15  27......VRLVRESFAVVEP--HAEEVAQFFYGMLFTIEPSAREMFPA------NMQVQRSRLLRALVHVVQMVDRPDDLVPFLQQLGRDHRKFG---VVSTHYEAVGMALISSVKKFAGPAWTDEVERAWAEAYTIMARSMLDAA.. 154
278 3.000e-39UniRef50_K9YEZ7 Globin n=1 Tax=Halothece sp. (strain PCC 7418) TaxID=65093 RepID=K9YEZ7_HALP7  ali  20  10......VELLENSYSEIRPRAN--EFAISFYQNLFSLYPETQPLF-----AHVDMAKQQQMLISALNLVVKNLRKPNLFKQTLKGLGSRHVRYGAL---PEYYPLLKEALLKTFQDYLQDRWTAETRQAWTEAFDAITKLMLDGY.. 138
279 3.000e-39UniRef50_Q9I0H4 Flavohemoprotein n=787 Tax=root TaxID=1 RepID=HMP_PSEAE  ali  19  2.LSNAQRALIKATVPLLETG--GEALITHFYRTMLGEYPEVRPLFNQAHQASGD---QPRALANGVLMYARHIDQLQELGPLVAKVVNKHVSL---QVLPEHYPIVGTCLLRAIREVLGEQATDEVLEAWGAAYQQLADLLIEAEES 140
280 4.000e-39UniRef50_A0A2W2E3R7 Globin n=2 Tax=Micromonosporaceae TaxID=28056 RepID=A0A2W2E3R7_9ACTN  ali  22  2.....DVSRLKQSWSLVAA--HGDQVPLYFYSTLFLAYPETRQMFP------TNMAGQRDRLVTALGHIVSQVDQLDHLVGYLQDLGADHRKF---AVRAEHYPAVGEALLATLRHFLGDQWTDELAQDWTAAYGLVSKVMTEAAQA 132
281 4.000e-39UniRef50_A0A2D9KZA2 NO-inducible flavohemoprotein n=2 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2D9KZA2_9GAMM  ali  16  1.MKPETFDIIHQTVPLLEQ--HGEQLADCFYKNMFRNNPEVNVFFNPAHQQSG---AQQHALASVICAYARHIDNPGQLRQALEVIFHKHVSLG---IKPEHYPIVGNNLLLTLREVLGEAATTEVIESWTEAYGVLAGIFIDREDD 138
282 4.000e-39UniRef50_A0A1W6B9V0 Nitric oxide dioxygenase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1W6B9V0_9GAMM  ali  15  2.LSERQKELVKATVPVLK--ENGEALTDYFYKRMLKNNPHLKETFNMGHQRSG---AQAKALAGAVLAYAENIDDPSVLMPVVELICHKHVSL---NIQAPDYNIVGENLLHSISEVLNIPMDDELIAAWGVAYQQLADIFIATEKQ 139
283 4.000e-39UniRef50_UPI0007322D17 hypothetical protein n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0007322D17  ali  21  1.MTPEHIAAVKASWEQLRPISEQTAF--LFYTRLFEQHPDLHGMF------RTDSREQGHKLLAMLDTAVASLADLDALEPDIRELGGRHVGYG---VMDGHYPLFEDAMHWALSQGLGDGWTADVEAAWRALFGRLSRTMRAGA.. 133
284 4.000e-39UniRef50_UPI000C80DFBC hypothetical protein n=1 Tax=Defluviimonas sp. MS2-2 TaxID=2056283 RepID=UPI000C80DFBC  ali  25  55.LSAREVQVIRDNFRAV--QDRIVPASLEFYEALFRRRPDLRPMF------REDLTGQGMKFMSTLEAVVDSLESPEAIADRMEELGHSHAALG---VKAEHFVPMGEALIETLRKYVGEGWTAEADAAWRKAYDEVAGRMLAG... 186
285 4.000e-39UniRef50_K9VX73 Globin n=8 Tax=Cyanobacteria TaxID=1117 RepID=K9VX73_9CYAN  ali  21  5......VELLEQSFEKIKP--HADEFAASFYENLFQLYPEVQPLF-----ANTEMAKQQKKLLNALVLVVENLRSPEALEPVLKVLGERHIGYGAI---ANSYPAVGEALITTFEQYLQQDWTTEVKQAWIDAYGAITALMLKGA.. 133
286 5.000e-39UniRef50_A0A225NHY4 Uncharacterized protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A225NHY4_9RHOB  ali  20  2.LTQTEIAAIRSSW--LAVVADRDRAGELFYDNLFRTAPETKSMFNASA------RVQGRKLMETLAIVVEGLDQFDALLPTLRHLGQVHAELG---VRREHYEIVGTTLIKTLGDAAGGKLDPQQEAAWRKAYWTVADIMKAAA.. 134
287 5.000e-39UniRef50_UPI000D335C23 hemin receptor n=1 Tax=Mangrovicoccus ximenensis TaxID=1911570 RepID=UPI000D335C23  ali  20  11.LTPEQISTVKQSFARIFPIK--AKLAYDFYERLFEIAPDLRPLF------SEDISIQREKLADTLAWAVRNLDSPAVLAEVVQGLARRHVTYGAL---PEHYPVVGAALIHALQLNAPGGLSEAETGAWTAAFETLSDIMIDAAR. 144
288 5.000e-39UniRef50_A0A0L0FSV3 Uncharacterized protein n=1 Tax=Sphaeroforma arctica JP610 TaxID=667725 RepID=A0A0L0FSV3_9EUKA  ali  17  48.LSQKTIDIVKSCAPVLEV--HGYDIAANMYKRMFANHPEVAELFNPSHQPNKDGKAQPWGLSCAVHAYALYIDDLGMLAEAVERIAQKHVSL---DVLPEHYGIVGENLLWSIKDTLGDAATPEIMAAWEEAYGFLAWVFIQREE. 189
289 5.000e-39UniRef50_A0A1I6PAG7 Methyl-accepting chemotaxis protein n=73 Tax=Bacteria TaxID=2 RepID=A0A1I6PAG7_9RHIZ  ali  25  690..SAAQVAIVQRSFATVQALGD--TAAELFYGRLFDIAPQVRSLFP------DDMTAQKRKLVAMLALAVANLDKPEALVAAVRDLGDRHVGYGALQ---AHFEAVGAALLWTLEQGLGPDFTPEVREAWTETYRVIAGLMT..... 818
290 5.000e-39UniRef50_D2AQM5 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductase-like protein n=4 Tax=Streptosporangium TaxID=2000 RepID=D2AQM5_S  ali  19  4.....DIGLIRRSWSLVEPVAD--QVTQHFYGRLFANYPHIREMFP------PAMDLQRDRLLHALTQVVLNLEDGAGLNDYLGQLARDHRKYG---VQPEHYPAVGSCLVAAMRFNAGGAWLPAYDEAWMTAYNYIAEVMIQAAEQ 134
291 5.000e-39UniRef50_A0A2W1JHN3 Bacterial hemoglobin n=2 Tax=Acaryochloris sp. RCC1774 TaxID=1764569 RepID=A0A2W1JHN3_9CYAN  ali  18  16..SPMNIELLERSFEQIRPQ--AIAFSNHFYETLFRHNPGIKPLF-----ANISQQAQGKKLIFSLAAIIENLRSPEVLEPALKSLGARHFEVGTL---EEHYPLVGQALFETFAAYLGSDWTPATMDAWQEAYEAIATIMLEGAQN 150
292 5.000e-39UniRef50_A0A258C1Q6 Nitric oxide dioxygenase (Fragment) n=1 Tax=Pseudomonadales bacterium 32-61-5 TaxID=1970544 RepID=A0A258C1Q6_9GAMM  ali  21  1.MTAEQTAIIKATVPILETG--GETLTKHFYGHMLTSHPEVVPFFNKAHQASGD---QPRALANAVLMYAKNIERLGNLGPLVGQIINKHVSL---NINPAHYAVVGACLLKAIRDVLGAEATDAVIDAWAAAYGQLADILIGAEK. 138
293 5.000e-39UniRef50_I3CJ89 Hemoglobin-like flavoprotein n=2 Tax=Beggiatoa TaxID=1021 RepID=I3CJ89_9GAMM  ali  19  2.LKASDIQLVCRSWEKLSPIPEGIILGQKFYKNLFTLDPSLKTLFK------GDLTEQSIHFMHIMDTIVNAIDKVDDLSDVVARLGVRHVGYG---VQEADYAVFGKALLMTIEQTLADAFTPELKQAWENTYNTLAELMKKGAEA 139
294 5.000e-39UniRef50_Q7NSD8 Flavohemoprotein n=59 Tax=Bacteria TaxID=2 RepID=HMP_CHRVO  ali  22  2.LSEQTRSLVKATVPVLQQ--HGVALTSHFYRRMFEHNPELKNVFNQGHQHSGQQQQ---ALAMAVLAYARHIDDPSPLLPVLTRVAHKHVSLG---IRAEHYPIVGKHLLASIRELLGEAAGDDLIQAWAEAYGLLADTLI..... 134
295 6.000e-39UniRef50_A0A254W6J0 Uncharacterized protein n=1 Tax=cyanobacterium TDX16 TaxID=1503470 RepID=A0A254W6J0_9CYAN  ali  21  5......VELLESSFAQIKV--NSLEVTKQFYTVLFTDYPEVQPLF-----ANTNMEKQRKQLFQSLVFTVNNLGKPATLSDTLRGLGTRHTQYG---VLPQHYPMVGSSLLKAFEVSLGTAWTPDVQQAWTEAYEVVTQLMLKGAD. 134
296 6.000e-39UniRef50_A0A2R5GMN0 Flavohemoprotein n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5GMN0_9STRA  ali  17  2ALSRKTIDVVKATAPVVA--EHAVEITSTFYPLMFKNNPEVLTFFNKGHQKEG---RQPRALADAVVAFASHIEDLGAIKPAVDKIAARHVAL---SVKPEHYAIVHKNLMAAIGQVLGDAVTPEIGQAWSDAVLALAGICIDAEEA 140
297 6.000e-39UniRef50_A0A210PFB5 Cytoglobin-2 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PFB5_MIZYE  ali  18  53.FTDRQRELVVQTWGII--QEDMTRVGVVMFMRLFETHPDVQDVFMPFKGQSKELKAHALRVMNTVEKCLGQMNEPAKLQEMLHDLGTRHVMYSA---KVDYIDLIGPQFIWAIQSSVGDQWTPEVEQAWSDLFKLISHYMKAAM.. 198
298 6.000e-39UniRef50_H3KC31 Nitric oxide dioxygenase n=8 Tax=Proteobacteria TaxID=1224 RepID=H3KC31_9BURK  ali  21  2.LTPNQISLVKATIPVLR--EHGVALTAHFYARMLKGNPELRQVFNQGHQRAG---RQQEALAAAVLAYAEHIENPAALLPAVEHIAGKHVSVG---IRAEHYPIVGRHLLASIQEVLGDAATPELIEAWGAAYGQLAGILIEKE.. 137
299 7.000e-39UniRef50_A0A165T7F8 Hemin receptor n=1 Tax=Halioglobus sp. HI00S01 TaxID=1822214 RepID=A0A165T7F8_9GAMM  ali  18  1.MPPEQIHLVKTALAAMTPI--AEQAADTFYARLFEQNPPYRALF------TGDMRAQGKMLIAILNTTVMSIDRREAVVPAIQALGKRHVGYG---VTAADYDAVGEALLWTLARWLGEAFTPDTRTAWTTTYSVLADTMNEAA.. 133
300 7.000e-39UniRef50_A0A1H8TRS9 Flavohemoprotein n=197 Tax=Bacteria TaxID=2 RepID=A0A1H8TRS9_9RHIZ  ali  15  5.LTETTKAIVRATVPAL--TTNGTEITAAMYKRLFE-NSNVRDLFNQSNQ--GEEGRQTKALAQAILAYAQNIDNLAVLTGAVERIAQKHVGL---HIRPDHYPHVATALLGAIRDVLGEVATDDILNAWGEAFWFLANILIGREKQ 142
301 8.000e-39UniRef50_A0A1Y5HRR3 Hemin receptor n=1 Tax=Oleispira antarctica TaxID=188908 RepID=A0A1Y5HRR3_OLEAN  ali  22  1.MNPTTIHNVQSTFDLIAPIADDAA--ALFYSKLFELDPSLKSMFKS------DMADQRKKLMQILGVAVSSLHNLAAIVPAVQDLGRRHVKYG---VRPQHYNTVAEAILWMLGQTLGASFTPAIKQSWTEVYTVLAETMVAAANE 135
302 8.000e-39UniRef50_R7TFF7 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7TFF7_CAPTE  ali  18  20.FTDRQKAIITKTWRHM--GNDLTGRGSKVFLKIFNLHPEVKQLFPSLKNDNEDFRGHASRFMQSVGAVVENLDTPGDLSPLLIDLGRKHVLFG--GFTPEYFAAFTEGMMCIWSEELGKGFTDEVSVAWKTVFDFIMSQLQDGY.. 166
303 8.000e-39UniRef50_A0A168BN42 Flavohemoprotein n=5 Tax=Hypocreales TaxID=5125 RepID=A0A168BN42_9HYPO  ali  19  2ALTPSQVTIVKSTAAVLK--DKGGEITRIFYANMLAAHPELRNLFSLRNQATGAQQAALG---AAVLAYAAYIDDLPRLQSAVERIAHKHASL---FVRPEQYAIVGEHLVGAFAEVLGDALTPEVADAWTAAYAQLADVFIGRERA 140
304 9.000e-39UniRef50_UPI000B9EBEF1 hypothetical protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9EBEF1  ali  18  2.LDARTIATVQATIPLLEQAN--TALTTNFYQRMFKWNPELKHIFNVSNQHN---SSQPKALFNAILAYAKHLHEPGRLAEMVEHIAQKHTGF---MILPEHYPIVGQHLLATLQELAPEAATAEVLAAWDKAYAALADIFIQRESE 139
305 1.000e-38UniRef50_A4C946 Probable bacterial hemoglobin n=2 Tax=Pseudoalteromonas TaxID=53246 RepID=A4C946_9GAMM  ali  21  1.MTPHQVELVQASWEKVVPIAK--DAADLFYGKLFELNPALRPLF------HGDVEEQGKKLMQILTTVVRGLKQFDKLEMAVWQLGRRHVAY---QISIQDFNTVAEALLWTLQQGLQQAFSAEVKQAWVEAYTIVAGVMQAGME. 134
306 1.000e-38UniRef50_A0A2J5PGG5 NO-inducible flavohemoprotein (Fragment) n=4 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2J5PGG5_KLEPN  ali  18  2.LDAQTIATVKATIPLL--VETGPKLTAHFYDRMFAHNPELKEIFNMSNQRNGD---QREALFNAIAAYASNIDNLPALLPAVEKIAQKHTSF---QIKPEQYNIVGSHLLATLDEMF--SLGQEVLDAWGKAYGVLANVFIGREAE 137
307 1.000e-38UniRef50_D3V8J6 Flavohemoprotein n=37 Tax=Gammaproteobacteria TaxID=1236 RepID=D3V8J6_XENBS  ali  16  2.LDSQVIATVKSTIPLI--VSTGPKLTAHFYERMFKHNPELKDIFNMSNQLNG---AQREALFNALCAYASNIDNLQALLPAVEKIAHKHTSL---NIQPEHYQIVGTHLLATLDEMFHPG--DEVLNAWGKAYEVLADVFINREED 137
308 1.000e-38UniRef50_UPI0004E0AF16 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain n=1 Tax=Methylacidiphilum infernorum (isolate V4) TaxID=481448 RepI  ali  19  1.MTREEIKMIQKSW--LRVIDKMDEAGLLFYRRLFDVEPKVRPLFKI------DIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYG---VKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIE.... 131
309 1.000e-38UniRef50_K1QF07 Neuroglobin n=5 Tax=Crassostrea TaxID=6564 RepID=K1QF07_CRAGI  ali  24  7..SEDEKRLVKDSWNLFVSRGDFSDTGSHMYKVLLQDNPHLKTLFSFMKVNSPMFKSHVRNVFTVIGDAVNHIDDLDSLSPILKDLGVKHQGYGA---KKEYLEPVGNALLCTIEKHLEDDFTQEVHSAWRTFFAVMSYSFAQGLDE 153
310 1.000e-38UniRef50_D3B1S6 Flavohemoglobin n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B1S6_POLPP  ali  20  4.LDAKTIEIVKSTIPALAGT--GSKLTQHFYARMLGNNPELKNVFNEANQRSN---AQSEALFGAVCAYAQNIDNLAPLLPAVEKIAQKHCSL---NIKPEQYSIVGENLLATIDELLAPP--KEVIDAWAAAYGVLADIFIQREKE 139
311 1.000e-38UniRef50_Q5DVM4 Putative haemoglobin n=2 Tax=Opisthokonta TaxID=33154 RepID=Q5DVM4_ASPNG  ali  22  3.LTPEQIKIIKATVPVL--QEYGTKITTAXYMNMSTVHPELNAVFNTANQVKG---HQARALAGALFAYASHIDDLGALGPAVELICNKHASL---YIQADEYKIVGKYLLEAMKEVLGDACTDDILDAWGAAYWALADIMINRE.. 138
312 1.000e-38UniRef50_A0A244CTZ1 Hemin receptor n=1 Tax=Pseudoalteromonas ulvae TaxID=107327 RepID=A0A244CTZ1_9GAMM  ali  19  1.MTPVQVELVQSSWEKVVPIAK--QAADLFYGRLFELNPQLKRLFK------DDIDEQGKKLMQILTTVVRGLKQFDRLEMAVWQLGRRHQVY---RIAPEDFNTVAEALLWTLEQGLQRAFTPDVKQAWVEAHTIVASVMQAGM.. 133
313 1.000e-38UniRef50_F0XSA6 Flavohemoprotein n=1 Tax=Grosmannia clavigera (strain kw1407 / UAMH 11150) TaxID=655863 RepID=F0XSA6_GROCL  ali  16  2ALTYKQSKLVRESIPHLR--EHGERISSIFYATMLDEHPELRSYFNTVNQQNG---RQPRALTTIILAFATNISHTSELIPRLERVCHKHCSLG---IQPQQYAIVGEYLIRAFRDVLGTAMTTELQSAWTDAYCVLARMMMGRE.. 138
314 1.000e-38UniRef50_K0KJ85 Flavohemoprotein n=5 Tax=Phaffomycetaceae TaxID=115784 RepID=K0KJ85_WICCF  ali  15  3.LTDKQKEIITASIPFLE--SNGVELTANFYAYMLETYPEVRPFFNKTHQKT---KSQPKILAFALVNYAKNINDLTPLLGFVRQIVEKHVGL---QVTPEQYDIVGTCLLKTLSEMLGEAATEEFIEAWKVAYFDLANILIGLEKE 140
315 2.000e-38UniRef50_UPI000D55BCBB hemin receptor n=3 Tax=Sphingorhabdus TaxID=1434046 RepID=UPI000D55BCBB  ali  23  11.LTVAEIDIVRRSF--LNLGDENARAGELFYQQLFDDKPELKSLF------LSDISVQSEKLTNMLGMIVSQIHNMPELLPMLADLARRHLGYG---VEAEHYRDVGDALISTIRDVLGPKFGPDVEAAWTKAYEGIALTMIQ.... 141
316 2.000e-38UniRef50_A0A1R1EP31 Flavohemoprotein n=5 Tax=Bacillales TaxID=1385 RepID=A0A1R1EP31_9BACL  ali  20  2.LDSKTIEIVQSTAPVLKQ--HSEQIGKKFYELLFAKAPDLYNLFNQTNQKRG---LQQEALGYAVYAAGEHITNLDAIMPVITRVTQKHRAIG---VKPEQYPLVGETLLEAVKEVLGSAATDEIIGAWGKAYEYIAEAFIQIEQD 139
317 2.000e-38UniRef50_A0A0P9TRY3 Bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2 n=1 Tax=Pseudomonas amygdali pv. dendropanacis TaxID=235272 Re  ali  18  28.LSTAHHDIIKATVPILETG--GEALTTHFYRIMLNDYPQVRPLFNQANQANG---AQPRALANAVLMYARNIDRLENLGPLAAQIVNKHVAL---QILPEHYPIVGACLLRAIREVLGAEATDAVIDAWAAAYQQLADMLINAERD 166
318 2.000e-38UniRef50_V4PJ00 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=V4PJ00_9CAUL  ali  22  1.MTPAQIRLVQASHAEVVTL--GATAAEVFYTHLFVLDPSLKPMFRS------DLAAQGKKLLQALNFVATQLHQPERILPAVRELGLRHVAYG---VQPEHYVTVGAALIATLAQALGERFDLATRQAWTEAYGLLSSTMIDAA.. 133
319 2.000e-38UniRef50_A0A1W2GDV4 Nitric oxide dioxygenase n=2 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2GDV4_9BACT  ali  19  8..TPYNKKLVRATFWMVEPKAD--EAAEIFYTKLFEMSPELRPLFK------GNMRDQGKRMMEMLSTVVKGLNTLDVLAPLVRSMGRRHVNYG---IKTEHYNMAAAALMYSLKEELQENWNEEVESAWLEVYQTVSDIMQSA... 138
320 2.000e-38UniRef50_A0A1I2UKR5 Flavohemoprotein n=5 Tax=Oceanospirillaceae TaxID=135620 RepID=A0A1I2UKR5_9GAMM  ali  19  6......IEIIKQTVPVI--QERGEEITQHFYHLLFEENPELKDVFNMASQSNG---RQPASLANAILGYAANIDRLAALGDAVNNIATKHFSL---DIQPEQYPIVGRNLLKAIREVLGAEASDDVINAWAEAYGQLANILIGAEKA 139
321 2.000e-38UniRef50_A0A2C6DL71 Flavohemoprotein n=349 Tax=cellular organisms TaxID=131567 RepID=A0A2C6DL71_9GAMM  ali  16  2.LDSQTIAIVKSTIPVL--VETGPKLTGYFYERMFKHNPELKDIFNLSHQQSG---AQREALFGAICAYASNIENLSAILPAVERIAQKHASF---NIQPEQYNIVGHHLLATIDELLHPG--TEVIEAWGKAYQVLANVFIQREAQ 137
322 2.000e-38UniRef50_A0A2B4SEQ9 Neuroglobin n=2 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SEQ9_STYPI  ali  17  34.LTADTKNTLRESWKLVEPLK--TEAGKLMFVRLFETHPNIQDTFPTFKMNSRSLYLHAKRVMAAVDNAINALDDCEVLIESLTSLGQRHQ---AWSVMEDHFAVVGEALLWTLQDLLQSKCTSQVLEAWTELFKFITKTMLVGIR. 180
323 2.000e-38UniRef50_A0A2B4SX20 Neuroglobin-2 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SX20_STYPI  ali  19  30.LTDLQTELIRGSWEKVKTNKKY--HGERLFHKLFDVAPHLQELFPFSDLTNPMFTMHALNIMNTLDLAVQNLDKLDILVPKLRELGQMHAAFELTEVE---FQYVGESLIWVLETGLGDDFTPKLKRAWCDAFAIISSVMLGAIKD 171
324 2.000e-38UniRef50_UPI000B5A9DAB hemin receptor n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A9DAB  ali  24  3...PHQHHLVRESWKKLSPIRD--TAAELFYQRLFSVYPELAPMFK------GDMKVQGEKLMQMLDKAVDSLENMESSIEPLKQAGRAHRSYG---VNEEDYEKFANCLFWTMKEGLGKAFDAPTREAWANTYATLSSIMIEGA.. 133
325 2.000e-38UniRef50_W0LFP8 Hemin receptor n=1 Tax=Chania multitudinisentens RB-25 TaxID=1441930 RepID=W0LFP8_9GAMM  ali  20  1.MSADRIKLIQESWKKVGPIADSA--AQIFYEKLFTLDPSLRSLF------RTEAYVQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVNYG---VKEEYYDTVGAALIYTLGASLKEEFTEEIKQAWVEFYALLSGVMKSAVK. 134
326 2.000e-38UniRef50_M2X487 Nitric oxide dioxygenase n=1 Tax=Galdieria sulphuraria TaxID=130081 RepID=M2X487_GALSU  ali  20  9....EEIQIVQQSWNKLEDRQYL--IGEAFYHSLFETYPSVKPLFRS------DMEKQKRLLIHMINKGVKLLNDIDKLESALSSLGKRHIKYG---VKEEHFPCVGETLLKVLKQFLGDEFDEKTLKAWESVYQYWAVFMLDGMK. 139
327 2.000e-38UniRef50_S8BSP3 Uncharacterized protein n=2 Tax=Orbiliaceae TaxID=47021 RepID=S8BSP3_DACHA  ali  15  11..TPEQAAIVKSTVPVLEQY--GVTITSTFYQNMHRDIPELHEIFNQANQKNG---HQARALATAVLAYAKYIDNLSVLGEAVELICQKHASL---LIQPGHYDIVGKYLLAAIKEVLGGAAADEIVSAWGACYWQLAYIMIDREEQ 147
328 2.000e-38UniRef50_A0A239UBQ6 Putative flavohemoprotein n=188 Tax=Staphylococcaceae TaxID=90964 RepID=A0A239UBQ6_9STAP  ali  15  2.LTEQEKDIIKQTVPVL--QDKGVEITSFFYNRMFNEHPELRNMFNQTNQKKG---LQSTALAQTVLAAAANIENLGAIMPVVREIAYKHCAL---QVPPAGYEIVGENLIAAIMEVLGLEEDDPVIKAWTNAYWEIANVFIDVEKQ 139
329 2.000e-38UniRef50_A0A1I6VYH6 Hemoglobin-like flavoprotein n=1 Tax=Yangia pacifica TaxID=311180 RepID=A0A1I6VYH6_9RHOB  ali  22  3.LTPQNISDIRASWQVLAADADG--FTADFYAALFRRDPGLRPLF-----AHTDLPAQRKKLVAALALVVRHADDLSPVLGPLEEMGARHVGYG---VKNSDYATVGGALIETMEAHLCEAFSSEIREAWTAAYGAVASTMMAGAQA 138
330 2.000e-38UniRef50_UPI0009DC12DF hypothetical protein n=1 Tax=Planktothrix agardhii TaxID=1160 RepID=UPI0009DC12DF  ali  22  180..TTAQIELVETSFEKIKPR--AVEFVSSFYQNLFETYPETQRLFGKT-----DMDKQGKKLLNSLILLVEGLRTPEALIPVLKDLGARHKGYGTIT---EYYPLVGEILLKTFADYLQEDWTPQVAQSWVEIYTKTSQLMLEGA.. 312
331 3.000e-38UniRef50_F4CV93 Nitric oxide dioxygenase n=63 Tax=Actinobacteria TaxID=201174 RepID=F4CV93_PSEUX  ali  17  33......VETIRRSWAAMEDQAD--ALGRHFYATLFHIAPETRDLFPV------NMEVQRSRLLRALVHVVQMVDQLDDLVPFLQQLGRDHRKFG---VIAGHYDAVGKALLSAIGTHAGDGWTPEVEKAWTDAYTLAGQAMSQAADA 162
332 3.000e-38UniRef50_A0A1M6D0U9 Nitric oxide dioxygenase n=1 Tax=Rubritalea squalenifaciens DSM 18772 TaxID=1123071 RepID=A0A1M6D0U9_9BACT  ali  17  3ALSKETIETVKATIPFLA--ENATKLTAHFYQRMFRENPEVRAYFNAAHQVSGS---QQGALAASVCAFARNIETPENLATAVSLIANKHASLG---VQPEHYPIVGKHLLASIDELLNPA-PPEILQAWGEAYGFLAEVLIQQEK. 139
333 3.000e-38UniRef50_I3KRJ1 Uncharacterized protein n=11 Tax=Percomorphaceae TaxID=1489872 RepID=I3KRJ1_ORENI  ali  19  26SLSAESREAIRSSWKEI--QEDISRVGVIMFVRLFETHPECKDAFFAFRDASKELKAHGLRIMYIIEKTVARIDQDDRLDQLILDLGRKHYQYKAL---PKYYDLMGEEFIQAIHPVLQERWTSDLEEAWKTLFLYITRTMKKGYQQ 175
334 3.000e-38UniRef50_A0A2N9N0S6 Uncharacterized protein n=2 Tax=Candidatus Sulfopaludibacter sp. SbA3 TaxID=2043164 RepID=A0A2N9N0S6_9BACT  ali  21  9.LSERQKRLVRESFESIGEYSDS--VVLLFYGRLFELAPQVRGLFKI------EIREQAVKLLDMLKTVVDALDRFEELRPQLAELGRKHAGY---NVQPAYYQVLVTALMWAFGQALGLEFTRETRTAWEALLGAISSVMLEGA.. 141
335 3.000e-38UniRef50_E5A9L7 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E5A9L7_  ali  20 1148ALTPDQVAIIKATVPVLA--EHGITITSKFYADMLTAHPELKNVFNNTHQVTG---HQPAALAGALYAYASNIDNLGALSPAVELICHKHASL---FIRPEQYDIVGEYLLKTMATVLGDAATPEILNAWGAAYWQLADIMIGAE.. 1284
336 3.000e-38UniRef50_A0A2A4VU89 Hemin receptor n=1 Tax=Kordiimonadales bacterium TaxID=2030814 RepID=A0A2A4VU89_9PROT  ali  21  1.MTPDDVAKLQYSFGQMVPKKD--EIAKVFYERLFEVAPAVRPLFK------GSIEEQGQKLVMALRQIVLSLKQPNELTTFLKGLGERHVGYGAV---AAHYDVVGGVLLWTFENVMGNDFTPELKELWGGAYGVISAAMQEAA.. 133
337 3.000e-38UniRef50_A0A239GBZ1 Ferredoxin-NADP reductase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A239GBZ1_9ACTN  ali  22  4.....DIELIRRSWSLVEPA--AAKVAAHFYGKLFADHPGVRELFP------PAMGDQRDRLLGALTRVVLNLEAGPGLVDYLGQLARDHRKYG---VRPEHYPAVGACLIAAMRANAAGSWRPEYSEAWAEAYQTIADVMIKAAAQ 134
338 3.000e-38UniRef50_A1ZN75 Neuroglobin n=2 Tax=Cytophagales TaxID=768507 RepID=A1ZN75_9BACT  ali  23  1.MTTQDINLVRNSW--VSVLAHRDEAGDIFYNYLFKQNPQVKRLF----QSNTHIQNQ--KLMSSITLIVTKLNKLDNIKEEVKFLAKRHVNY---QVKPAYFTAFGNAFLYMLAQVLGNAWTHEMKTAWKKVYQLISQAMIEGL.. 133
339 3.000e-38UniRef50_K2HBC4 Flavohemoprotein n=14 Tax=Bacteria TaxID=2 RepID=K2HBC4_9BACI  ali  22  9.LDERTREIVKATVPVLA--EHGEAITTHFYKRMLTERPELKNYFNMTHQKDGK---QPRALANAVYAAASHIDDLSAIAPAAETIAEKHVSL---NIRPEHYPIIGEYLLKAIKEVLGDAVDEEVIDAWELAYGEIADLFISIEDE 146
340 3.000e-38UniRef50_A0A2S9YM25 Flavohemoprotein n=2 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A2S9YM25_9DELT  ali  16  1.MHPKQIELIRASLPILR--EQAVAITQAMYRRMFTANPEVAKMFNPSHMHPD---GQQGALAGAIVAYAEHLDELEVLHDALAVIVHKHV---AVQVQPAQYEVVGEHLLAAIAEVLGDAATPELMHTWAAAYRELADVCIAAER. 137
341 3.000e-38UniRef50_F5UFD7 Globin n=6 Tax=Cyanobacteria TaxID=1117 RepID=F5UFD7_9CYAN  ali  23  174......VEILESSFEKVKPRAD--EFAASFYENLFIAHPEFKPLF-----ANIELEKQQKKLINALVLVVENLRSPEALGPVLNALGGRHIGYG---VIPKYYGPVGDALLMSFEQSLQEDWTPEVKLAWTDAYRAITGLMLKGA.. 302
342 4.000e-38UniRef50_A0A1Q7BWH8 Flavohemoprotein n=1 Tax=Actinobacteria bacterium 13_2_20CM_2_71_6 TaxID=1803494 RepID=A0A1Q7BWH8_9ACTN  ali  20  6.......RLLKESWTLVE--EHQDRVAGYFYARVFLSHPQVRDLFPV------QMDVQRARLLGAIVTAVQTLDDPERFDEYLRSLGRDHRKF---HVNPEHYDVVGAALIESLRTFAGEHWSIEYDQAWRDAYAVIARKMMAGAEE 134
343 4.000e-38UniRef50_UPI000D6FBE35 hemin receptor n=1 Tax=Roseomonas sp. CQN31 TaxID=2184016 RepID=UPI000D6FBE35  ali  23  3ALTEEELDRVRGSFRALAAL--GEDGAATFYDRLFATSPGLRALFP------EDIGPQCTKLMSMLGVIVARLHDHAALQPLLADLARRHVGYGA---RPEHYAGVGEALLWTLGQRLGPEFTPAHADAWRRAYAALSATML..... 133
344 4.000e-38UniRef50_A0A1K2FMD5 Flavohemoprotein n=84 Tax=Actinobacteria TaxID=201174 RepID=A0A1K2FMD5_9ACTN  ali  18  1.MSDSQ--ALRDSFALV--GKSGDEVPRYFYSYLFLIAPEVRPMFPVA------MGAQRDRLVAALGRIVAEADDPDRLIPFLQQLGRDHRRF---QVVAQHYEAVGQALLATLAYFLGDAWTPELQRGWTEAYSLVARTMIQAAEA 133
345 4.000e-38UniRef50_K8YWN8 Nitric oxide dioxygenase n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=K8YWN8_NANGC  ali  18  27.LSPHIVSVVKSTAPVLAAQ--GPRITQVFYPLLFSRYPAVQELFNKRNQADGTPARQPQALANAVWAYAANIDNLSALSAAVSLIAHKHASL---HVLPEHYPMVGECLLAAIAQVLGPEATVEVLKAWEQAYGFLAAVFVQTED. 170
346 4.000e-38UniRef50_R7QRC5 Uncharacterized protein n=2 Tax=Rhodymeniophycidae TaxID=2045261 RepID=R7QRC5_CHOCR  ali  19  7..TPETIAIVKSTVPILR--ENLTEVITRFYENLFSTYPELKKQFNMDRHRGGTVKEQVAALGGAVISYAKNIDRVEALLPVVERISHKHVSRG---VSAAQYDKIGECLLRAMKDILEEAITEDIHNAWAEAYGFLASVFIN.... 148
347 4.000e-38UniRef50_UPI0009B12FDE hypothetical protein n=1 Tax=Spirosoma rigui TaxID=564064 RepID=UPI0009B12FDE  ali  21  29SMTPMQLAAIKSSWAL--AVPHADAVGKAFYANLFTIDATLRPMF------ADDINGQSGKFVAMVTRLVNHLDDADTVTREITGLAQRHTHYG---VRPAHYTTAGQALVQTLSDGLGEHWTPPVQEAWGALYQTIASAMISAAEQ 166
348 4.000e-38UniRef50_A0A1H5FDF8 NAD(P)H-flavin reductase n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H5FDF8_9ACTN  ali  23  62........LVRRTMAEVAPVAD--KVTSYFYALLFVRHPELRSLFPAA------MDTQRDRLLKALLTAAEHIDNTEVLVAYLQNLGRGHRKYGT---RPEHYPAVGECLIGALNKYASDVWDAETEAAWVRAYTTISQVMIDAA.. 187
349 5.000e-38UniRef50_G8SE21 Flavohemoprotein n=146 Tax=Actinobacteria TaxID=201174 RepID=G8SE21_ACTS5  ali  20  6.......RLLKESWSLVE--EHQDKVAGYFYARMFLSYPDLRDLFPV------QMDVQRTRLLHAIVTAVQTLEDPERFEDYLRSLGRDHRKF---HVLPEHYEVVGGALIESMRAFAGEQWGVEYDQAWADAYAVIAAKMLAGAES 134
350 5.000e-38UniRef50_A0A2A8HZX9 Uncharacterized protein n=1 Tax=Novosphingobium sp. PC22D TaxID=1962403 RepID=A0A2A8HZX9_9SPHN  ali  17  5.LSAKTIATIKASAPALQQ--HGVAITTRMYERLF-INPEIEAMFDRAAQESGE---QPRRLAGAILAYAQNADKLENLGGAVERMAARHVEAG---VRAEHYPLVAQALLPAIRDVLGDEASDELLEAWGEAYWYLAEILINAENA 141
351 5.000e-38UniRef50_UPI00047F7324 hemin receptor n=1 Tax=Mesorhizobium sp. WSM2561 TaxID=1040985 RepID=UPI00047F7324  ali  18  1.MTPDQIRLVQDSFHEVLPIR--VAAAALFYERLFAIDSDLRALF-----LASDMPKQGAELMASLGSVVRGLDRANTVLPTVRELAKRH---GACGFKEHHYPIVGQALIDTMAAGLGTAFTPAVGEAWEAAYALLASVMIAAARE 136
352 5.000e-38UniRef50_B4WLV9 Globin domain protein n=5 Tax=Cyanobacteria TaxID=1117 RepID=B4WLV9_SYNS7  ali  15  2.....DVALLEKSFEQISPR--AIEFSASFYQNLFHHHPELKPLFAETSQ-----TIQEKKLIFSLAAIIENLRNPDILQPALKSLGARHAEVGTIK---SHYPLVGQALIETFAEYLAADWTEQLATAWVEAYDVIASTMIEGADN 133
353 6.000e-38UniRef50_A0A0F4K3A3 Flavohemoprotein (Fragment) n=1 Tax=Streptomyces sp. NRRL S-444 TaxID=1609134 RepID=A0A0F4K3A3_9ACTN  ali  21  2.....DARILKSSFAVVERR--AEHAVKYFYSHLFWHNPGIRELFPSSG---EDMERQRDRLFAALTHVVAHLDD-EGLLPYLHHLGRDHRKFLA---RPEHYAAVGSSLLAALARTSGEAWTPGVEKAWSEAYQVIADAMMEGA.. 132
354 6.000e-38UniRef50_A0A0E9MYQ4 Putative globin-like protein n=1 Tax=Flavihumibacter petaseus NBRC 106054 TaxID=1220578 RepID=A0A0E9MYQ4_9BACT  ali  24  1.MTKEAIRLVQQTWVTVIPVS--QTLGEAFYRKLFTAEPLVKHLFK------TDIKEQACKLTQMFTHIISHLDRLEDVRGDLHRLGQRHNQY---KVKPEYYAIVGESLIATLEQQLGEKWTGATKAAWIDFLTIVFEAMMQG... 132
355 6.000e-38UniRef50_A0A1Y1I094 Non-symbiotic hemoglobin n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I094_KLENI  ali  21  23.LTQEKVGLIQSSYAKIDEKIGALGFGKEFYTVLFEMAPAAQALFKSGR------EAQSKMFAGMLTTLVKNIDNADKVVPVLQALATRHVRYG---VKEAHFPIVGAGLLATLEKVLATDFTPPVREAWTELYGITQTVMWAKMEE 159
356 6.000e-38UniRef50_A0A164IVT5 Flavoprotein n=17 Tax=Nocardiaceae TaxID=85025 RepID=A0A164IVT5_9NOCA  ali  18  1.MDSRTVALIRTTFKAVAAEDGGPELARSFYAILFTEHPFVRDFFPAA------LDSQRDRLVKAIAYVVDRLEEPDQLLPFLAQLGRDHRKYG---VSTEHYAAVGKSLHAALRAYAGTEWTDEVERAWNEAIGVIAETMMRAADQ 139
357 6.000e-38UniRef50_T0RU19 Globin n=3 Tax=Oligoflexia TaxID=1553900 RepID=T0RU19_9PROT  ali  21  4.....DINMIRSSFEKAKPI--AGDVANKFYEFLFQDYPASKGLF-----TDVNMAAQKKALINSLVYIVDHLEDGEKLTNYLKKMGSRHVNYGT---EPEHYSWVGQSLLKTFAFFFGDEWTPELKSQWTQAYTFIAETMLEGAEN 135
358 6.000e-38UniRef50_A0A1Y0RKQ8 Globin n=1 Tax=Nostocales cyanobacterium HT-58-2 TaxID=1940762 RepID=A0A1Y0RKQ8_9CYAN  ali  22  189......VEILVSSFEKVKPRAD--EFAASFYENLFKAHPEVKPLF-----TKTDMKNQEKKLLNSLVLVVENLRNPEALRSVLNALGDRHVGYGAI---PKYYGPVGEALLVTFEQYLQQNWTSELKKAWVDAFRAITALMLNGTRQ 319
359 6.000e-38UniRef50_B4WP36 Globin domain protein n=2 Tax=Cyanobacteria TaxID=1117 RepID=B4WP36_SYNS7  ali  19  4.....DVELLEQSFELVKPKAD--DFVASFYNNLFTDYPDAKPLFEHTN-----MAAQQQMLKGALVMVVDNLRRPEVLSKSLKGLGARHIKYGAL---PEHYPLVGNSLIKTLEQYAGPAWNSKLESAWAGAYSAITELMLEGA.. 133
360 8.000e-38UniRef50_A0A2G2JR25 Flavohemoprotein n=1 Tax=Blastopirellula sp. TaxID=2024826 RepID=A0A2G2JR25_9PLAN  ali  23  5......IKLLEDSFELLAPQGD--ALVERFYDNLFNDYPVVRPLF-----ENVEMQEQRSKLLAGLALVVANLRSPDQLVPALEEMGQRHVEYGAV---EDYYPAVGATLLKSLAEIAGDAWNDELEQAWSDAYGEISKIMLAG... 132
361 8.000e-38UniRef50_UPI000D146B18 hypothetical protein n=1 Tax=Streptomyces sp. NRRL F-5123 TaxID=1463856 RepID=UPI000D146B18  ali  18  7.......QALKDSFALV--GKSGDEVPRYFYSYLFLIAPEVRPMFPV------NMGVQRDRLVNALGQIVSDVDDPDTLVPFLQQLGRDHRRF---QVVAQHYDAVGRALLATLGYFLGEAWTPELEKGWTEAYTVVAGAMVQAAEA 135
362 8.000e-38UniRef50_R7V3H8 Uncharacterized protein (Fragment) n=5 Tax=cellular organisms TaxID=131567 RepID=R7V3H8_CAPTE  ali  21  1.LSEQTIQIVKATAPVLA--EHGETITRHFYQQMFSQNPELLNIFNATNQKTG---RQQAALANAVYAYAANIDNLGVLTAAVQRIAHKHASF---NILPEQYPIVGKHLLEAVAHVLGDAATDEILNAWKEAYGFLAALFIEVEE. 137
363 8.000e-38UniRef50_A0A2P9HXX3 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=12 Tax=Actinobacteria TaxID=201174 RepI  ali  18  19SLNPR---LVKESFSVVEPMADKA--TAYFYGRLFAENPHLRGMFP------PAMDVQRDRLFGALTRIVWSLDSPDSLAAFLGQLGRDHRKYG---VIAEHYTAVGNALLATIRRFAADVWNHEIEAAWVSAYTAAANLMIESAES 151
364 8.000e-38UniRef50_A0A2T6DZ03 Hemin receptor n=1 Tax=Opitutaceae bacterium EW11 TaxID=2161865 RepID=A0A2T6DZ03_9BACT  ali  17  19SLTPEETHLIRTSFDAV--LRRPVEAAAQFYEALFSEAPGVRGLF------HGDMRTQGQKLIATLSLLVSRLDDLPSLEPALAELGRRHRNY---RVDRDHYSLVRRALLRMLSVNSGPEWSPAAECAWGRIYDHVAATMMAAAD. 153
365 9.000e-38UniRef50_UPI0003F0C79F globin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0C79F  ali  19  22.LDDRQKRIVRKTWRPLA--NDMTENGQKIFINIFESHPEIKYMFPTRDIANPHFRMHSSRFMQSVGAAIDNLNDLDALRPLLVKLAKTHVRF--KGFKPDYFDAFEEAMLSVWQEELGQRFTTEVEESWKLLFFYIKDCLKEGYD. 170
366 9.000e-38UniRef50_A0A225B4J8 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A225B4J8_9EURO  ali  18  3.LTEEQINIIKATVPVV--QEHGNTITSVFYKNMLHENPELNNYFNTTNQLNG---HQQGALARALYAYAANIDNLAVLGPAVETITHKHASL---HILPEHYKVVGTYLLAAMKEVLGDALTPDIHDAWAAAYWQLADLFIAKED. 139
367 9.000e-38UniRef50_UPI0004B39E39 hypothetical protein n=1 Tax=Chania multitudinisentens TaxID=1639108 RepID=UPI0004B39E39  ali  22  589GLSADRIKLIQESWKKVGPIADSA--AQIFYEKLFTLDPSLRSLF------RTEAYVQRKKLIDILTLGVKGLENIERLIPTLQSLSLRHVNYG---VKEEYYDTVGAALIYTLGASLKEEFTEEIKQAWVEFYALLSGVMKSAVK. 723
368 9.000e-38UniRef50_A0A1H8K2Y1 Nitric oxide dioxygenase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1H8K2Y1_9BURK  ali  21  2.LSVEQKAIITATVPILEQG--GETLTRHFYLTLFRDFPHVKPFFNQANQQDGN---QQRALANAVLMYAKNIDRLEQLGPLVSTIVNKHVSL---QIQREHYPLVGASLLKAIREVLGDTATDAVIDAWAAAYGQLADILAGAEQ. 139
369 1.000e-37UniRef50_UPI000B8E4BF3 cytoglobin-2-like n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=UPI000B8E4BF3  ali  21  82.LTERQKELLEETWKELEG--NIAKVGVITFISLFETHPDVQQVFMPFNKHSKQLRAHALRVMAFVQKAVARLHEPEKLETILQELGKKHYTYGA---KQKYVDLIGPQFIQAIQPSLEDRWTPELQEAWIHLFKYMAYVMKTGEEE 231
370 1.000e-37UniRef50_A0A2P9F1U1 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=27 Tax=Streptomyces TaxID=1883 RepID=A0A2P9F1U1_9ACTN  ali  18  118........LIRRTMAEVGPVAD--KVTSYFYALLFVQHPDLRSLFP------PAMDAQRDRLLKALLTAAEHIDNTPVLVDYLQNLGRGHRKYGT---QPEHYPAVGECLIGSLSRYAPTTWDDETEAAWVRTYTTISQVMIDAA.. 243
371 1.000e-37UniRef50_E9EJD6 Flavohemoprotein n=1 Tax=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) TaxID=655844 RepID=E9EJD6_METRA  ali  23  74.LTSEQMKIVQSTIPALEQ--HGMAITSLLHKRLLDSHPELKNVFNTTHQVTGE---QPAALAHAVWAYASNIDNPAALQTTLSRIGHKHASLG---ITPEQYPILGEGLLAAIKTVLGAAADDQVLDAWGAAYEKLAEYCIR.... 207
372 1.000e-37UniRef50_A0A2K9UYR2 Globin-like protein n=5 Tax=Actiniaria TaxID=6103 RepID=A0A2K9UYR2_ACTTE  ali  24  23.LSKAQKYLVRETWETVELYKN--NVGKQTFLRFFENNPEFQKLFPEFKQKANALHGHAKRVMKAVENAVSAMDDAVSFSAYLEELGRRHV---ARSLKPSYLDAMQAALMDSLRQTLQSEWTDETAIAWNKLFRFIADTMITGLQS 170
373 1.000e-37UniRef50_UPI0009DA4C24 hypothetical protein n=1 Tax=Pannonibacter phragmitetus TaxID=121719 RepID=UPI0009DA4C24  ali  21  10..TPEQIRLVQASFDRLRPQ--GASIVSGFYCRFFELSPTLRPLF------RTPLPAQELRLLEALSAVISMLSNLQMLLPELEALAKRHVTYG---VSAAHYHAAGDALLWTLERHLGEAFTPAVRSSWIAAYATLSDIMIASAE. 142
374 1.000e-37UniRef50_S9QGF4 Putative bacterial hemoglobin n=2 Tax=Salipiger mucosus TaxID=263378 RepID=S9QGF4_9RHOB  ali  24  2.LTQGEIKAIRASWLLVAA--NRAELGERFYKNLFRAAPEVRPMFTNGP------RVQGRKLMETLAIVVDSLDDLAPLLPTIRQLGASHAALG---VRPEHFDLVGRILLQTLVEAAGEEMPNGATDAWTKAYQAVASAMINEE.. 134
375 1.000e-37UniRef50_A0A246WU54 Flavohemoprotein n=19 Tax=cellular organisms TaxID=131567 RepID=A0A246WU54_9BURK  ali  20  2.LTDAQLAIVKSTVPLLESG--GEALTTHFYKMLMRDYPQVRPLFNRTHQASGD---QPRALANGVLMYARHIDRLEALGPLAAQIVNKHV---AVQIMPEHYPMVGDCLLRAIREVLGAEATDAVIDAWGAAYGQLADILIGAEQQ 140
376 1.000e-37UniRef50_UPI000D75B6E2 hemin receptor n=1 Tax=Sinimarinibacterium flocculans TaxID=985250 RepID=UPI000D75B6E2  ali  27  1.MNAEQIRLVRETWKLILPMR--AAVAELFYSKLFELEPRLRPLFKS------DLERQGEKLIAMLDAAVRGLDHPHVLGPALKDLGQRHVRYGAS---ENDYGTVAVSLLWTLEQSLGAAFTVDARRAWTEAYATIVAMM...... 129
377 1.000e-37UniRef50_P24232 Flavohemoprotein n=2080 Tax=root TaxID=1 RepID=HMP_ECOLI  ali  18  2.LDAQTIATVKATIPLL--VETGPKLTAHFYDRMFTHNPELKEIFNMSNQRNGD---QREALFNAIAAYASNIENLPALLPAVEKIAQKHTSF---QIKPEQYNIVGEHLLATLDEM----FSPEVLDAWGKAYGVLANVFINREAE 137
378 1.000e-37UniRef50_W7YVL1 Flavohemoprotein n=2 Tax=Bacillus TaxID=55087 RepID=W7YVL1_9BACI  ali  20  2.LGQETIKTIKATAPVLA--EHGLAITTHFYTLLLEQHPELWHVFNHANQKRG---IQQQALADSLYAAAVHIEQLEAIVPVVKKIAHKHRSIG---VQAEHYPIVGDYLLKAMKDVLKEDATDSILTAWEEAYSVIAKLFIETE.. 137
379 1.000e-37UniRef50_A0A1Z4S992 Globin domain protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Z4S992_9NOSO  ali  20  5......VEVLEQSFQQVKPR--ASEFVTSFYDNLFIAHPEVKPLF-----ANIDMARQHNMLLNALVLVVENLRKPEVLGQALKGLGARHVGYGAS---PQHYGAVGEALLVTFEEYLQQDWTPEVKQAWLGAFEVIEAEMLQGA.. 133
380 2.000e-37UniRef50_A7RJ19 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7RJ19_NEMVE  ali  27  39.LTERQIKLVQDTWRLLIPSQKKT--AMIFYLKLFTLDPIFKEVFSFHTENEGQLEQQSRKFMEMINSAVDRLNDISLLVMILKSLGEVH--WTKFKIKPEYYEPVGKALIYSISKGLGSLFNDEIGEAWQAMYDLMSGAMISGTKA 186
381 2.000e-37UniRef50_UPI0009DC99C5 hypothetical protein n=1 Tax=Myxosarcina sp. GI1 TaxID=1541065 RepID=UPI0009DC99C5  ali  24  1.................................MFTAYPEAQPLF-----ANTNMAKQKKMLVSSLVLVVENLRNPDVLTSSLKGLGARHVKYGAL---PAHYPLVGNALLTTFEQYLDDKWTPDVKQAWVDAYGAITEIMLDGAD. 105
382 2.000e-37UniRef50_A0A1G8ZND7 Nitric oxide dioxygenase n=1 Tax=Bradyrhizobium sp. Rc2d TaxID=1855321 RepID=A0A1G8ZND7_9BRAD  ali  21  1.MNTAQRELVQTTFARLAVM--PEVAGALFYERLLAKNPSFRPLFNN------NMRIQGLKLMSMLAMVVYNLPEPDQVSTALRDLAVRHVEYG---VKPADYDAMREALLWTLEQALGEDLTPAAREAWTVCYNELAGEMKAAA.. 133
383 2.000e-37UniRef50_UPI000C6D695A neuroglobin-like n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6D695A  ali  23  45NLTPQQIQLVRSTWSIVSQ--DMVGVGTIVFQRFLTRHPELCKMFRKFMTLKDDLQRHALLVMQALEAAIDNLDDSRVLAGILYDLGRRHARY---NVQEQMFDKLWEALRYGLEKSLQNRMTREVNQAWFAVFKYISWQVIKGMRD 195
384 2.000e-37UniRef50_A0A1G9CS02 Nitric oxide dioxygenase n=1 Tax=Methylophilus rhizosphaerae TaxID=492660 RepID=A0A1G9CS02_9PROT  ali  21  2.FSEAAVPYIKASVPVLR--EHGVKITTVFYNSLFNTHPELRNVFNMRNQADG---TQQQSLAAAVFAYAANFENPAALAPVVTRIVHKHASLG---IVPEHYPIVGTHLLGAIKEVLGDAATPELIDAWAEAYGALANALITEEKN 139
385 2.000e-37UniRef50_A0A2H5B1T3 Oxidoreductase n=2 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2H5B1T3_9ACTN  ali  22  6.......AVIRASFAIVELRAD--HAAKYFYTHLFAHNPELRQLFPA------DLAEQRDRLFASLTELVLRTDDLDGLTGYLRALGRDHRKFQA---QPEHYPAIGASLIAALRQFSGHSWTPEIEKAWTEAYTVISQVMIEGA.. 132
386 2.000e-37UniRef50_UPI000585BBB2 flavoprotein n=1 Tax=Nocardia cerradoensis TaxID=85688 RepID=UPI000585BBB2  ali  22  1.MDSRTVALIRTTFKAVAAEDGGEQLARSFYALLFTEYPQLRDFFPAA------LEVQRDRLVKAIGYAVDRLEEPEQLLPFLAQLGRDHRKYG---VVAEHYAAVGNSLKSALRAHAGTEWTDEVEQAWDAGLGLISETMIGAAE. 138
387 2.000e-37UniRef50_UPI00041900BD flavohemoprotein n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=UPI00041900BD  ali  13  26.......ELTRRSWAVVEPRAD--EVGSQFYAILFHIAPEVRDLFPV------NLEVHRSRLIRALVHVAHQTDDMDELLPFLHQLGRDHRKFG---VRPEHYDAVTTALVGGIRKVSGEAWTPEVEDAWRETLALAATAMRTAAD. 153
388 2.000e-37UniRef50_A0A2P8ADH4 Flavohemoprotein n=36 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2P8ADH4_9ACTN  ali  17  46..TDEDVALVRASLTVVTP--HVSELAAHFYSILFSRYPQVRDLFPA------ELDVQRERLVRALLRIVELVDDPDNLVAFCSRLGRGHRKFGT---QSGHYPAVGECLLQALSHFAGPAWHPALATAWQRAYTAAADVMVRAAEE 179
389 2.000e-37UniRef50_Q0UPY5 Uncharacterized protein n=51 Tax=Fungi TaxID=4751 RepID=Q0UPY5_PHANO  ali  19  4.LSPSQVQIIKSTVPVLAQ--HGEAITAKFYTDLLTANPSLKNVFNTTHQATG---HQSRALAGALYAYAANIDNLGALSPALELICHKHVSL---FIQPAQYAIVGEFLLATMKTVLGAAATGEVLDAWGAAYWQLADIMIAKEE. 140
390 2.000e-37UniRef50_A0A076MRI5 Globin n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A076MRI5_AMYME  ali  20  2.....DIPRLRASWATVA--ERGDEVPLWFYATLFLLRPSLRDLFPVS------LASQRTRFVSALGQIVTHVDDLDAAVPYLRRLGRTHREAG---VRPEHYPVVGQALLATLEHFLGERWTPELAADWTSAYAVVAEVMTNAE.. 130
391 2.000e-37UniRef50_A0A0J9V4N9 CMGC/CDK/CDC2 protein kinase n=1 Tax=Fusarium oxysporum f. sp. lycopersici (strain 4287 / CBS 123668 / FGSC 9935 / NRRL 34936) Ta  ali  23  27ALIPEQIKVVQSTIPALE--KHGLEITTLFYRQLLNKHPELKNIFNTAHQDTGE---QPAALAHAVWAYAANIENPEAMKAAISRIGHKHASLG---VTADQYPIVGQGLLSAIKQILGDEVNSRVLDAWDAAYYQLAEYFI..... 160
392 2.000e-37UniRef50_A0A2T5GUY2 Hemoglobin-like flavoprotein n=4 Tax=Sphingomonas TaxID=13687 RepID=A0A2T5GUY2_9SPHN  ali  22  1.MDSRQINLVQDSFIHVLPIPD--AVAAAFYARLFQLAPDTRPLF------RGDMVEQGRKLVLTLASVVDSLDRLDELLPVARELAIRHVGYG---VLDRHYAVVGAALLDTLAVQLGDLFDTATHDAWAAAYTILADAMIEA... 132
393 3.000e-37UniRef50_UPI0009F9A05D hypothetical protein n=1 Tax=Bradyrhizobium sp. AS23.2 TaxID=1680155 RepID=UPI0009F9A05D  ali  19  333........IVQSSFHQVAPR--LMAFGERFYTVLFEENPELRGLFKN------DLAVQQRMLVSMLNSLVKGLNRLTEIEGGVRALGRRHCRYG---VRSDHYGKVANALLLTLAEFLGDDFTPEIRASWIAIFGTISELMVDGAE. 459
394 3.000e-37UniRef50_H2MRF9 X globin n=51 Tax=Gnathostomata TaxID=35060 RepID=H2MRF9_ORYLA  ali  21  29...EEQIQMIKDSWKVIR--DDIAKVGIIMFVRLFETHPECKDVFFLFRDTNRELRAHGLRVMSFIEKSVARLDQPERLEALAVELGKSHYHYNAP---PKYYNYVGAEFICAVQPILKEQWTTELEKAWQTLFQFVTALMKQGYQE 175
395 3.000e-37UniRef50_A7SFV0 Predicted protein n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SFV0_NEMVE  ali  23  18.LSEAQKYLVRETWETIEPQK--QTVGKKAFLRFFDMNPDYQNLFPEFKQKANALHGHAKRVMKAVENAVMSIDDVMSFSAYLEELGRRHK---TRALKPSYLEAMHGALMDTLRNLLQSQWTEETAEAWNKLFSFISTTMVRGLQS 165
396 3.000e-37UniRef50_A0A1Z4J4C8 Globin domain protein n=2 Tax=Scytonema TaxID=1203 RepID=A0A1Z4J4C8_9CYAN  ali  23  171.......DLLEKSFATIKPR--AQEFVASFYENLFIAHPEVKPLF-----ANIDMVTLQKKLLNALILVVENLRNPESLGQVLSALGARHVGYGAL---PKYYPAVGEALLTTFEQYLQADWTPEVKQAWVNAFRAITAGMLQGAQA 300
397 4.000e-37UniRef50_A0A2K1QKL9 Uncharacterized protein n=1 Tax=Elsinoe sp. CQ-2017a TaxID=1983410 RepID=A0A2K1QKL9_9PEZI  ali  23  3.LTTDQKTLITSSLPAL--QEHGATVTTSFYTTLLSENPSLRSTFNLTHQRT---ASQPFALASVLAAYARHITDPSVLGPAVEAINHRHVSLG---VTAEQYSVVGTYLLRAMSEVLGQAFTEDLKGAWGAAYGDLASGMVKAEEE 140
398 4.000e-37UniRef50_UPI00089D11D8 flavohemoprotein n=1 Tax=Micromonospora pattaloongensis TaxID=405436 RepID=UPI00089D11D8  ali  18  6.......RLLKESWTLVEEQQD--KVAGYFYARMFLSNPHLRELFPV------HMDVQRARLLGAIVTAVQTIDDPERFDEYLRSLGRDHRKF---RVEPEHYNVVRDALLEAFRTFAGEQWSIEYDQAWIDAYDLIARKMLSGA.. 132
399 5.000e-37UniRef50_A0A0L1JAY5 Flavohemoprotein n=1 Tax=Aspergillus nomius NRRL 13137 TaxID=1509407 RepID=A0A0L1JAY5_ASPNO  ali  21  26..........QATVPVLQQ--HGTNITTVFYDNMLTAHPELNAVFNNANKTNG---HQPRALAGALFAYASHIDDLGALGPAVELICNKHASL---YIQPDQYQIVGKFLLEAMGQVLGDALTPEILDAWATAYWQLADLMIGREAE 154
400 5.000e-37UniRef50_A0A2G2M2M7 Methyl-accepting chemotaxis protein n=3 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2G2M2M7_9GAMM  ali  18  44.....EIELLEESFAALAPQ--GEALAARFYERLFDKYPEVKPLF-----EGIPIDGQQKKLLASLVLLVQNLHKPEILKDYLYSLGARHVQYG---VIEAHYPLVAENLLAVMAEFAGELWTDEVKQAWQNTLNTVATIMIEANES 175
401 5.000e-37UniRef50_A0A2K9UYQ6 Globin-like protein n=2 Tax=Exaiptasia pallida TaxID=1720309 RepID=A0A2K9UYQ6_EXAPA  ali  20  20.LTEEKKTLLRKTWAI--ASQPSVQAGNKLFKTLFQIAPSASTYFSSTDIDADDFQRHIQLVMGTLGTAIDNLDDLSVIVPGLQGLGATHDSLG---VRIEYFKYVKQALLQTLSQELQDAFTDDCREAWTLAFDVIVGAMISGM.. 158
402 5.000e-37UniRef50_F7SSF2 Nitric oxide dioxygenase n=54 Tax=Gammaproteobacteria TaxID=1236 RepID=F7SSF2_9GAMM  ali  19  2.LTHEQETLINATAPVVA--EHLNAITQRFYPLMFSRYPEVKPLFNEVHQQSG---GQPRALANAVLAYVQLRSNPAQARATLDVVVSKHVSLG---ILPEQYPIVGECLLAAIGEVLGDAVTPEIADAWGALYNELAALLIDLEDQ 139
403 5.000e-37UniRef50_A0A1G7N3F9 Nitric oxide dioxygenase n=11 Tax=Halomonadaceae TaxID=28256 RepID=A0A1G7N3F9_9GAMM  ali  17  2.LTKDQERLIDATAPVVA--EHLNTITSRFYPLMFERYPDVAPLFNQTHQTNG---AQPQALAGAVLAYVQLRREPARARQVLATVVSKHVSLG---IRPDQYPIVGECLMAAIGEVLGDAVTPEIADAWGALYEELAGLLIE.... 135
404 6.000e-37UniRef50_A0A0B0EJ45 Uncharacterized protein n=1 Tax=Candidatus Scalindua brodae TaxID=237368 RepID=A0A0B0EJ45_9BACT  ali  14  3.LTDKTIKIIKATAPVIE--EKAIEFAKTFYPIMLSRYPGLIIFFNQAHMHNG---TQPRAFAASIVEYANSIENLDAIKPLVNDIAEKHASL---DIKPVQYKLVTACILETIEDVLGDRGTPEVMAAWKEAIDNFANIIIETER. 139
405 6.000e-37UniRef50_F2Q9W9 Globin n=3 Tax=Branchiostoma TaxID=7737 RepID=F2Q9W9_BRAFL  ali  24  29.LTQEQVHGIKETWAILAQ--DPVERGVGLFMKIFEEDPDLKKLFYFADDGRERVRSHGERVMEAVGGAVDSQGDLTAVVPVLTELGALHHKYG---VQPSYFDTVGAALIYILETNLGDKLTPSIRQGWVLVYGIVGATMKKGMQQ 175
406 6.000e-37UniRef50_A0A1W2TF38 Putative nitric oxide dioxygenase n=1 Tax=Rosellinia necatrix TaxID=77044 RepID=A0A1W2TF38_ROSNE  ali  18  2GLTRREAELVNETIPALQQ--HGEHISTVFYKSMLRDHPELNNYFNTVNMHTG---RQPRALTALILAFASNIVNISELTPKLERVAQKHASL---IVRPEHYEIVAKYLIRAFSAVLGPAMTPEVNAAWTKAYWLMAK-MLTGREA 139
407 6.000e-37UniRef50_S3FIT4 Globin family protein n=17 Tax=Bacillales TaxID=1385 RepID=S3FIT4_9BACL  ali  21  2.LDQQTIEIVKATAPVLK--DHGVAITSHFYKRMFANNPEVRQFFNHTNQQRG---RQPEALANAVYAAAVHIDRLEAILPAIQPALHKHQSL---NIRPEHYPIVGANLLGAIQDVLGEAATPEIIDAWAKAYGVIADVFISLEKQ 139
408 6.000e-37UniRef50_A0A132MU45 Nitric oxide dioxygenase n=4 Tax=Streptomyces thermoautotrophicus TaxID=1469144 RepID=A0A132MU45_9ACTN  ali  22  11....EQARLIRESFQVIAQ--HGDRVALHFFAELFLRHPELRDLFPVA------MSELRGGLFDAITTIVQRIVSTGTLVPFLQQLGRDHRKY---DIRTEHFAYVGEALMITLEKYAGEAWTPQVAEAWRSTYDLAAKVMLQAMQS 142
409 6.000e-37UniRef50_T2LEB6 Flavohemoprotein n=43 Tax=root TaxID=1 RepID=T2LEB6_9GAMM  ali  18  2.LTHEQEKLINATAPVVA--EHLNAITQRFYPLMFTRYPEVKPLFNEVHQQSG---GQPRALANAVLAYVQLRSNPAQARATLDVVVSKHVSLG---ILPEQYPIVGECLLAAIDEVLGEAVTPEIADAWGALYNELAALLIDLEDQ 139
410 7.000e-37UniRef50_A0A0F7M597 Hemoglobin-like flavoprotein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F7M597_9GAMM  ali  18  2.LQSEVINIVKSTAPILA--KEGEKITQLFYQKLFVNHPELQNVFNMTHQIQGD---QPRALADSVFKYASHIDKLEELGPLVKRIAHKHASL---SVAPEQYPVVGKYLLEAIGEHLNLPSDDPILSAWSDAYQQLAAIFVNTEE. 138
411 7.000e-37UniRef50_A0A239P0B9 Methyl-accepting chemotaxis protein n=2 Tax=Asanoa hainanensis TaxID=560556 RepID=A0A239P0B9_9ACTN  ali  18  10...QADAKLLTASLEVVADRAD--ALIASFYDRLFTEYPAVRPMFPAS------MDAQHDKLLGAIVALVTNYEDPEALRPTLLALGAKHDGWG---VQPAHYTAVAGCLLATLREYAGDAFTPEVEGAWVRAYTFAAGTMMQGA.. 140
412 7.000e-37UniRef50_UPI000BBD572A neuroglobin-like n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI000BBD572A  ali  14  24.LSKEQKELIKDSWSKIQQ--DVTKAGIIMFVRLFENHPECKDAFFSFRQASRELRAHGLRVMSFLEKSMARIDKPERLEKLVLELGRKHYHYHSN---PKYYMYLGLEFINVIKPILKDSWTSELEEAWKTLFLYLTQMMRLGYKE 171
413 7.000e-37UniRef50_A0A125P2G0 Flavohemoprotein n=2 Tax=Variovorax TaxID=34072 RepID=A0A125P2G0_9BURK  ali  17  2.LTPSTMAIVKATAPVLA--EHGFTIIQRFYEHLFQAHPELKNLFNMRHQERGE---QQRALAAAVLAYAANIDNLQALGPAVARITNKHASL---NVVPEQYAVVGHHLLEAIKEVLGDAATEPILEAWALAYQALADLMIGAE.. 137
414 7.000e-37UniRef50_A0A084R652 Uncharacterized protein n=2 Tax=Stachybotrys chartarum TaxID=74722 RepID=A0A084R652_STACH  ali  23  2ALTYKESQLVRASVPVLR--EHGEAVSRLCYSNLLTAHPELNNLFNPANQRNG---RQPRAFTAVILAFASHINHTSELVPRLERMCNKHCSLG---VRPEHYDLVGKFLLKAFAQVLGDAWNQPLYAAWAKAYSMLAKMLTARE.. 138
415 8.000e-37UniRef50_A0A2P8AIT6 Glutathione synthetase n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P8AIT6_9PEZI  ali  21  3.LADDQVSLVQSSIPALE--EHGTKITSTFYTTMLSENPSLRNIFNLTNQRTNS---QPLALASVLAAYATHITNPSALAAPVEAINHRHVSLG---VTAEQYNIVGTYLLRAMSEVLGAALTEELKGAWGAAYMELAGMMIKAEEA 140
416 9.000e-37UniRef50_UPI000CF4EDC8 hypothetical protein n=1 Tax=Rubritalea profundi TaxID=1658618 RepID=UPI000CF4EDC8  ali  20  5.LSTTMIETVKATIPFLQQ--NGQALTEHFYKRMFAGNPEVKEFFNQANQKTGN---QQQALGAAICAFAQNIETPENLAEAVSRISNKHASLG---IKPEHYPIVGEHQLDSIDDLLNPA-PKEILDAWAEAYGFLAGVLTGAEKS 141
417 9.000e-37UniRef50_A0A0Q4KPB2 Uncharacterized protein n=1 Tax=Sphingomonas sp. Leaf33 TaxID=1736215 RepID=A0A0Q4KPB2_9SPHN  ali  18  1.MHARQIEQIRDTF--VHVLFDPERAAGVFYGRLFDLAPETRPLFKS------DMDEQGRVLIRSLATIITGLSRFDAMVPTLTDLAIRHDGYG---VRRDHYAIVGTAIIDMLEVVCPDDFDDSVRAAWIEAYGLIADTMIAAA.. 133
418 1.000e-36UniRef50_A0A1G6VJH5 NAD(P)H-flavin reductase n=5 Tax=Rhodococcus TaxID=1661425 RepID=A0A1G6VJH5_9NOCA  ali  17  1.MDSTTISLVRTTFKDVAAVEDGARLTRDFYATLFAQSPAAREFFPAA------MDVQRDRLVQAIAYVVDKLDEPERILPFLAQLGRDHRKYG---IEEAHYIAVGNALITALRQFAGEMWTEEVDNAWREGIALIASTMIDAANN 139
419 1.000e-36UniRef50_W7T570 Cysteine desulfurase n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7T570_9STRA  ali  24 1393.LGPQAIQLVQSSFEVIKPAGD--AFCTCFYDRLFSQHPELETHFRYT-----DMKHQHASLLSALVLVIQELLDPSSLRSRLLQLGKRHFYYGAS---PAHYGHVGAAMLWALSTHLGERMTQEIHDAWSDTITFIATVMIEG... 1525
420 1.000e-36UniRef50_A0A0U5L7X2 Flavohemoprotein n=32 Tax=Bacteria TaxID=2 RepID=A0A0U5L7X2_9GAMM  ali  16  3..TSEQKDLVKATVPVLR--ENGVALTDYFYKRMLKNNPQLKETFNMGHQRSG---AQAKALAGAVLAYAENIDDPSVLAPVVELICHKHVSL---NIQAPDYDIVGENLLHSISEVLNISMEDKLIAAWASAYQQLADLFIATEKS 139
421 1.000e-36UniRef50_A0A1W2DDC8 NAD(P)H-flavin reductase n=30 Tax=Actinobacteria TaxID=201174 RepID=A0A1W2DDC8_KIBAR  ali  16  35......VRLIRESFAVVEPKAD--EVAKFFYGMLFSLSPNAREMFPA------NMEVQRSRLLRALVHIVQLVDRPDDLNPFLRQLGRDHRKFG---VISAHYEAVGTALIAAVKKFSGKSWTDEIERAWAEAYTIMARAMLDSA.. 162
422 1.000e-36UniRef50_A0A257FT98 Uncharacterized protein n=2 Tax=unclassified Burkholderiales TaxID=119065 RepID=A0A257FT98_9BURK  ali  16  10.........IEATLPVV--LEHGEAITRHFYQRMLGQHPELKNLFNLSNQSQGE---QAQALARAVYAYAAHMDQPLLIAPVLERIAHKHVSLG---ITPAQYTIVGRHLLASIGEVLGAAITVDIASAWDEVYWLMASELIARE.. 137
423 1.000e-36UniRef50_A0A0N0MML0 Nitric oxide dioxygenase n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A0N0MML0_9ACTN  ali  20  30........LIRRTLEEIGPVAD--RVTSYFYALVFTGHPEVRGMFPAA------MDAQRDRLLKALLTAAEHIDNPDVLVPYLRRLGSGHRKYGTM---AGHYPVVGEALISALARYADRSWGPETQAAWVRAYTAMSQIMIDAAAE 157
424 1.000e-36UniRef50_U3TZQ7 Globin n=1 Tax=Plautia stali symbiont TaxID=891974 RepID=U3TZQ7_9ENTR  ali  20  3..DAQTIATVKSTLPAIAQL--GPQLTGHFYQRMLTQHPELKNVFNMNNQRSGN---QREALFNAICAYGSNLENLAVLLPAVEKIAQKHASL---NIQPAQYAIVGENLLATIKELLGD----EVLAAWGKAYGVLAEVFIQRE.. 135
425 1.000e-36UniRef50_A0A2B4SPY0 Cytoglobin-2 n=3 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SPY0_STYPI  ali  26  21.LTTAQKYLVRETWETIEIHKNS--VGKKTFIKFFEKNPEYQRLFPEFKDVPPSLYGHAKRVMKAVENAVSALDDSESFSAYLEELGRRHK---TRALKPMYLDSMQEALMFVLQDLLESSWTEETADAWNKLFRFVTEHMTYGLQS 168
426 1.000e-36UniRef50_A0A258UVV7 Nitric oxide dioxygenase n=2 Tax=unclassified Thiotrichales (miscellaneous) TaxID=939858 RepID=A0A258UVV7_9GAMM  ali  17  3..SSDVMKTIQATVPVLA--EHGQAITTIFYQKMFAAHPELKNMFNMAHQAKGE---QQRALAEAVLNYASKIDQLVELGPMVKRIAHKHASL---NIQPEHYPIVGKYLLEAIQVFLNLPQDHEILRAWGVAYSALAQIFIDTE.. 137
427 1.000e-36UniRef50_A0A2I0S660 Flavohemoprotein n=1 Tax=Cercospora zeina TaxID=348901 RepID=A0A2I0S660_9PEZI  ali  20  19.LSQEQVKIIKATVPVLQQ--HGTDVTRLFYKNMLSERPELNNIFNQTNQVND---HQAGALAASLYAYATHIDDLGALSPAVEKICHKHASL---YIQPEQYGIVGEGVLRAFATILGDAFTPEIHEAWAAAYWQLANIMIGREKQ 156
428 1.000e-36UniRef50_J3NI61 Uncharacterized protein n=4 Tax=Fungi TaxID=4751 RepID=J3NI61_GAGT3  ali  16  2ALTYQQMKLVKSTVPVLK--ESGELIATTFYRDMLAENPRLREVFNSVNQKSG---RQPRALTQVMLSFANNVSHTSELIPTLEKICNKHCSLG---IQQADYSIVGRYLILAFAHVLGPAWTPDVELAWTKAYWVLAKMMIARE.. 138
429 1.000e-36UniRef50_A0A239E2Y4 NAD(P)H-flavin reductase n=4 Tax=Actinomadura TaxID=1988 RepID=A0A239E2Y4_9ACTN  ali  22  2.....DAQRLKDSFDRVA--EQGDAVALFFYSDLFVRNPHLRDMFPVG------MSGQRDKLLRALGHIVARVDDLPALVPFLQQLGRDHRRFG---IVAEHYPHVGASLLATLRHFAGDGWTDDVEGDWNAAYSLVAKVMLEAADE 132
430 2.000e-36UniRef50_A0A0B7KIA1 Uncharacterized protein n=1 Tax=Bionectria ochroleuca TaxID=29856 RepID=A0A0B7KIA1_BIOOC  ali  20  4..TQAQIDIVKATIPILK--EHGTTVTSTMYKNMIGNNPELRNVFSMRSQATG---AQPAALAASVLAYATYIDDLPKLQHAVERIAQKHVSL---FIQPDQYMIVAKYLIEAFGIVLGDAFTDEIKDAWVAAYLQLADVFIQRE.. 138
431 2.000e-36UniRef50_K1R7G1 Neuroglobin-1 n=8 Tax=Mollusca TaxID=6447 RepID=K1R7G1_CRAGI  ali  18  53.LTERQKELIMQSWQKI--QEDMSKVGVVMFMRLFETHPDVQDVFMPFKRHSSQLREHALRVMGTVEKCLARINEPKKMEEMLHDLGTRHVMYSA---KVDYVDLIGPQFIWAMQPALEDQWNTELEEAWSDLFKMMTHVMKNAMQ. 199
432 2.000e-36UniRef50_A0A2G7CD32 NAD(P)H-flavin reductase n=1 Tax=Streptomyces sp. 61 TaxID=2035242 RepID=A0A2G7CD32_9ACTN  ali  22  37.LSDREISLIRASVAEVEPL--AADMTVYFYAILFARYPEVRPMFP------PGMDAQRGRLLRALLRIVDLVDDPGGLVRFCGHLGRDHRKFGTL---AAHFPAVGECLLAALARFAGPAWSADVAAAWTKAYGAVAQVMIGAAEE 171
433 2.000e-36UniRef50_UPI000BA7EB78 cytoglobin-2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7EB78  ali  18  41.LTRNQRAILTNTSKLL--VENISRVGVITFMNLFETHPDVQEVFMPFKGLSGELRAHAFRVMGVVQKVITRLNEEEKLDQLLTDLGKKHARYGA---KPQYIDLIGPQFVHAIKPSLEDHWTTEMEEAWCQLFRYIAWVMKAAM.. 186
434 2.000e-36UniRef50_P49852 Flavohemoprotein n=1418 Tax=root TaxID=1 RepID=HMP_BACSU  ali  21  2.LDNKTIEIIKSTVPVLQQ--HGETITGRFYDRMFQDHPELLNIFNQTNQKK---KTQRTALANAVIAAAANIDQLGNIIPVVKQIGHKHRSIG---IKPEHYPIVGKYLLIAIKDVLGDAATPDIMQAWEKAYGVIADAFIGIEKD 139
435 2.000e-36UniRef50_A0A210Q3Q0 Neuroglobin n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q3Q0_MIZYE  ali  19  22.LTPRQIHLVQDTWDIIK--DDLSKLGVIVFLRLFETEPDLKHLFPKIVQMNEQLTKHAVSVMEGLGAAVESLDESEFLNSVLISIGQTHVK---RHVKPQMLKRLWPSLNYGLKQVLQSKYNKEVNEAWKKVYFYIVAHMKRGMEN 173
436 2.000e-36UniRef50_A0A1Q6YA85 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1Q6YA85_9CHLR  ali  23  4.....QGELLETSFQAI--VLHGEAFVTAFYERLFTRFPETRAFF-----AATDMFEQRKKLQQSLALIVQHMQHPEVLGDMLRELGQRHVTYG---IRPEHYPLVGAVLLETFADFLGKHWTQAHHDAWVKGYEAVSSLMLQGTQE 135
437 2.000e-36UniRef50_UPI0008350B6C flavohemoprotein n=1 Tax=Actinoplanes sp. TFC3 TaxID=1710355 RepID=UPI0008350B6C  ali  25  6.......RLLKESWSLVE--ENQDKVAGYFYARMFLSNPELRELFPVY------LEAQRTRLLRAIVTAIQTIEDPDRFDSYLHALGRDHRKF---HVEPEHFEVAGGALLEALRHYGGEQWSIEYDQAWADAYTVISTKMIAGA.. 132
438 2.000e-36UniRef50_A0A220SM61 Flavohemoprotein n=18 Tax=Bacteria TaxID=2 RepID=A0A220SM61_9GAMM  ali  17  2.LTADQLAVIQQTVPVL--QEHGETLTRHFYQRLFRENPEVKAYFNPAHQRSGS---QQRALAGAICAYAQHVDNPAALMGAVELIAQKHASLG---IRPEHYPIVGANLLASIREVLGEAASDDVIN................... 120
439 2.000e-36UniRef50_A0A2U1FLN9 NAD(P)H-flavin reductase n=1 Tax=Actinomycetospora cinnamomea TaxID=663609 RepID=A0A2U1FLN9_9PSEU  ali  14  188......VSLIRQSWASIQHRSD--ELTKLFYAWLFRLSPETRELFPVT------MELQRTRFLRGLLHVIQMVDRPEELSVFLRQLGRDHRKFG---VVDKHYDQVGEALVGALKEVTGERWNNEIEQAWLGAYSLTASIMLDAAE. 316
440 2.000e-36UniRef50_A0A2W4IVZ0 Flavohemoprotein (Fragment) n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4IVZ0_9ACTN  ali  16  6.......RLLKESWALVEDQQ--EEVAGYFYARLFLSNPELRDLFPV------QMNVQRARLLKAIVRSIQTIDSPEQFDDYLRSLGRDHRKF---LVEPRHYDLVRDALLEALREHGGERWSLAYEQAWRDAYDMIAARMQAGA.. 132
441 2.000e-36UniRef50_UPI0009E63069 neuroglobin-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E63069  ali  23  29SLSEETKNVLRESWKLVEPLKTVA--GKKMFERMFGSHPEVIYLFPIFKLCSRALHLHVKKVMSALENAVLSLNDAEKLTHYLINLGERHR---PWSVRMEHFDLLKESLLWTLQDMLQSKCTPGVSRAWSEMIDLVAEAMMQGLKS 177
442 2.000e-36UniRef50_J7L7S1 Globin family protein n=2 Tax=Nocardiopsis TaxID=2013 RepID=J7L7S1_NOCAA  ali  16  142......IDLVRRSCADV--PEGSTRLAKCFYDNLFAMVPEVRDMFPS------DIRPQQQRMADALLAVVRHLDSPDEIAEYLRRLGRQHHR--ELGVRPEHYPHVGRALVRAVSEVS-PTWTSSMSSAWVLVYQWITAHMMAGAQA 271
443 2.000e-36UniRef50_A0A1M5WEL6 Nitric oxide dioxygenase n=3 Tax=Rhizobiales TaxID=356 RepID=A0A1M5WEL6_9BRAD  ali  29  12.......................EAAAVLFYDRLFDIAPQMRAMFP------DDMIEQRRKLMAMLAGVVKGLGNLEQVLPAAGALAKRHVSYGA---KAEHYPVVGAALLWTLEKGLADGWTPEVADAWGTAYGTLSGYMISEA.. 124
444 2.000e-36UniRef50_A0A1H3TY46 Methyl-accepting chemotaxis protein n=1 Tax=Asanoa ishikariensis TaxID=137265 RepID=A0A1H3TY46_9ACTN  ali  17  10...QADAKLLNASLEVVADRAD--ALIASFYDRLFTEYPAVRPMFPAS------MDAQHDKLLGAIIALVTNYENPEALRPTLLALGAKHDGWG---VQPAHYTAVAGCLLATLREYAGDAFTPEVEGAWVRAYTFAAGTMMQGA.. 140
445 2.000e-36UniRef50_A0A1D7YGQ5 Hemin transporter n=6 Tax=Streptomyces TaxID=1883 RepID=A0A1D7YGQ5_9ACTN  ali  17  2.LSEPSAATVRATLPAVGAA--IGEIAERFYARLFAAHPELRDLFNRGNQASG---AQKQALAGSIAAFATHLEHPDRPDAMLGRIAHKHASLG---VAPGHYPVVHEHLFAAIVEVLGEAVTPEVAAAWDEVYWLMANALIAVEK. 141
446 2.000e-36UniRef50_A0A1Z4SBX9 Globin domain protein n=3 Tax=Nostocales TaxID=1161 RepID=A0A1Z4SBX9_9NOSO  ali  22  189......VDLLEISFEKIKPC--AEEFAASFYENLFKAHPEVKQLF-----TNIDMVNQHKQLLNSLVLVVENLRNPEALVPVLKALGRRHVAYGAI---PRYYGPVGDALLVTFEQYLQEDWTHEVKKAWVDAFRAITALMLKGA.. 317
447 3.000e-36UniRef50_A0A1Q6Z9S4 Uncharacterized protein n=2 Tax=Ktedonobacter TaxID=363276 RepID=A0A1Q6Z9S4_9CHLR  ali  20  87........LLKDSFNLVAP--HKEAFAQHFYSQLFARYPQTRQLFPPTEEG---MRRQESSLIATLAVIVAGVERGENLTQVIRNLGGRHQRYGA---QAAHYPLVGQLLLQTFQDFLGDAFTPQMKDAWSKAYEIISTEMLKGA.. 215
448 3.000e-36UniRef50_A0A0T9LRJ3 Flavohemoprotein n=20 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0T9LRJ3_9GAMM  ali  16  2.LDSQTIATVKSTIPLL--VETGSKLTEHFYDRMFAHNPELKDTFNMSNQFSGD---QREALFNAICTYAANIENLATLLPAVERIAQKHTSL---SIQPADYQIVGKHLIATLDEL----FSPEVLDAWAKAYGVLADVFIQREEQ 137
449 3.000e-36UniRef50_A0A1K0FUM1 Globin H n=7 Tax=Amniota TaxID=32524 RepID=A0A1K0FUM1_MYOLU  ali  20  96.......ELIRQSWQAVSRS--PLEHGTVLFTRLFDLEPDLLPLFPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLAGLGRKHRAVG---VKLSSFSTVGEALLYMLEKCLGPAFTPAVRAAWRQLYGAVVQAMSRGWD. 238
450 3.000e-36UniRef50_UPI00035CEF7B hypothetical protein n=16 Tax=Actinobacteria TaxID=201174 RepID=UPI00035CEF7B  ali  18  8.........LQASWARV--VAHGDAVPAYFYAALFTRNPQLRQLFPAS------MAGQRDRLVTALGRIVAGVGQPDVMLPFARGLGRDHRRF---DVRPEHYPPVGEALLATLSQFLGPDWDADLAAGWTEAYGLVAQVMCDAAAE 134
451 3.000e-36UniRef50_Q54D73 Flavohemoprotein B n=3 Tax=Dictyostelium TaxID=5782 RepID=FHBB_DICDI  ali  19  2.LSQKSIQIIKSTVPLLE--KYGVEITSLFYKNMFEAQPQFLNIFNHSNQRN---QKQPVALANTILQSAIHIEKLNEIN--LMPIVHKHVALG---ITPEMYPIVGAHLLGAMKTVMQDEATPEIMAAWTEAYRAVAQAFMDAEED 137
452 3.000e-36UniRef50_UPI000C03C159 cytoglobin-2-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C03C159  ali  15  29.LTDEQIKILKETWGIIEPTKK--EIGVNVYIRFLKMNPDIKSRFTEFKEISNKNNGHPRRLMAAIENSICSLYDPETFAGYVLELGRRHVRLRFKPTK-SHFIDLRKAFISTIKEFLTTDWRPEVEESWVLLFDFMAAVMMKGFNA 175
453 3.000e-36UniRef50_A0A1X6PD63 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6PD63_PORUM  ali  20  3ALSDDTVRIVKSTAPVLKV--HGGAIVDGFYALLFEQHPAAAAYFNXXXXXXXXSKAQIQRLSMAVLLYAESIDQLDTLGPVLERISAKHASRG---IPAEFYPAVGACLLQSIGRVLGDAATPEIVGAWGEAYGFLADALMATE.. 151
454 4.000e-36UniRef50_A0A0C2D0H0 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=1 Tax=Enhygromyxa salina TaxID=215803 R  ali  17  3...PTQIELIRASLPTLREQAIP--ITQAMYRRMFAANPEVARMFNPAHMHPD---GQQGALAGAIVAYAEHLDELEVLHDALAVIVHKHV---AVQVQPIQYDVVGGHLLAAIAEVLGDAATPELMDTWAAAYGELADVCIAAER. 137
455 4.000e-36UniRef50_A0A2K9UYP9 Globin-like protein n=4 Tax=Hexacorallia TaxID=6102 RepID=A0A2K9UYP9_EXAPA  ali  23  20.LSTAQKYLVRETWETIEQHKNP--VGKKTFLRFFDMNPDFQKLFPEFVGLNRELHGHAKRVMKAVENAVTAMDDAESFTAYLEGLGQRHVN---RALKPSYLDAMQVALMDTLKDLLQSQWTQETCDAWNILFRFIADTMKRGLQS 167
456 4.000e-36UniRef50_A0A292Z132 Flavohemoprotein n=16 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A292Z132_9PSEU  ali  18  25...ADTVATISRSWNLIEDRSD--ELGRHFYATLFHNAPETRDLFPV------NMEVQRSRLLRALVHVVQMVDQLDELVPFLQQLGRDHRKFG---VLTEHYDAVGDALMSAVATYSGDSWTPDVEKAWNDAYAIAGTAM...... 151
457 4.000e-36UniRef50_A0A143PM95 Nitric oxide dioxygenase n=1 Tax=Luteitalea pratensis TaxID=1855912 RepID=A0A143PM95_9BACT  ali  19  13..TRTQRDLVRQSLDRLTV--DAVPVTLLLYGKLFELDPSARRLF------HNDLAVQGRKLMDTLDAVASSLDNLESLRPRLLQLGRRHADYG---VGPADYDRLITALLWAFAQALGPDFDKPTREAWRVALSAVAAVMQEG... 143
458 4.000e-36UniRef50_A0A100JLH0 Ferredoxin--NAD(P) (+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=43 Tax=Streptomycetaceae TaxID=2062 RepID=A0A100  ali  19  119........LIRRTMAEVGPVAD--KVTSYFYALLFVQHPDLRSMFP------PAMDAQRDRLLKALLTAAEHIDNTLVLVDYLQNLGRGHRKYGT---QADHYPAVGECLIGALSRYAKASWNDETEAAWVRTYTTISQVMIDAA.. 244
459 4.000e-36UniRef50_A0A1V1YLG9 Hemin transporter (Fragment) n=1 Tax=Streptomyces sp. WAC00263 TaxID=1917422 RepID=A0A1V1YLG9_9ACTN  ali  18  2.LSEQSAATVRATLPAVGAA--IGEIADRFYERLFAAHPELRDLFNRGNQASG---TQRRALAGSIAAFATHLERPDVL---LNRIAHKHASLG---IAPEQYATVREHLFAAIAEVLGDAVTPEVEAAWDEVYWLMANALIA.... 138
460 4.000e-36UniRef50_A0A1E3QQ45 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QQ45_9ASCO  ali  17  3.LTDVQKDIIKASIPVLKTS--GVELTTRFYAHLLENHPDVRPFFNKAHQIT---KSQPKILAFALVAYAKNIDDLTPLLPFVHKIVVKHIGL---QVQARHYDAVGTSLLHTLHAFLGGDATPEFMGAWKVAYYDLANILIEAEKS 142
461 4.000e-36UniRef50_UPI000BB031AD neuroglobin-like n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BB031AD  ali  18  40.MSESEKRIVKKTWKYLA--RDMTYYGTRVFLRIFELKPDLKDLFPFHNKEDENFIGHASRFMQAVGAAIDNINNLHLFGPLLVGLGRQHVEFG--GFKPEYWDVFTEAMIFVWEKELGDNFDGRCKIAWRKIFEFIMEQLKDGYKQ 188
462 5.000e-36UniRef50_A0A2U8HHM8 Hemin receptor n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2U8HHM8_9RHOB  ali  23  7.LTPQHITDIRLSWQVLASDADG--FASGFYHRLFRRDPDLGPLF-----ASTDLPAQRRKLIAAIALVVRHADDLSPVLGPLAELGARHLGYG---VKTSDYTTVGGALIETMEAQMQGAFTPEVRDAWLTAYGAVAGTMM..... 137
463 5.000e-36UniRef50_A0A0U5EUZ4 Nitric oxide dioxygenase n=81 Tax=cellular organisms TaxID=131567 RepID=A0A0U5EUZ4_9PROT  ali  20  5.LDDTTRAIITACVPALEA--HGLDITREMYARLLA-DPAISALFNRSHQKNGE---QPTALALAVLMYARNINDLGKLGGMVERIAEKHVGL---NILPEHYPHVGTALLGAIKHVLGDAATPEIMDAWAKGYQFLADVLINREAQ 141
464 5.000e-36UniRef50_A0A254QUT0 Uncharacterized protein n=1 Tax=Phaeobacter sp. 22II1-1F12B TaxID=1317111 RepID=A0A254QUT0_9RHOB  ali  24  1.MTPDEIKALQMNFARIYPVKHS--VAKSFYDKLFELAPGVRALFP------DDMREQREKLADTLAFIVKNLDQPDKMELAVSSMARRHAGYGAL---PSHLPVVGEALIFALEDQSAGQMTPLEHDAWLKAYGRISDMMVD.... 131
465 5.000e-36UniRef50_A0A2M9JPB5 Flavohemoprotein n=13 Tax=Streptomycetaceae TaxID=2062 RepID=A0A2M9JPB5_9ACTN  ali  24  23.......ALIRSSLAV--AERRAEALTKYFYAHLFKHNPGVRAMFP------ERMEEQRDRLFAALTMAILNLEDTDALVGHLHTLGFDHRKFGT---RIEHYPAVGRSLIAALKVFSGSAWTPKTEAAWRAAYELISKIMIAGAQS 151
466 5.000e-36UniRef50_A0A1I3PRY4 NAD(P)H-flavin reductase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A1I3PRY4_9PSEU  ali  21  2.....DTARLRSSWNTVAGF--GGGVPLFFYSTLFLTRPHLRELFPAG------MSAQRDKLVRALGRVVASVDELDAAVPFLRQLGRDHRKF---AVTADHYPAVGQALLTTLEHFLGEEWTPELAADWAAAYKIVADVMTAAAKE 132
467 5.000e-36UniRef50_I3K2H7 X globin n=36 Tax=Percomorphaceae TaxID=1489872 RepID=I3K2H7_ORENI  ali  22  31...EDQIQMIKDSWKVIR--DDIAKVGIIMFVRLFETHPECKDVFFLFRDTSRELRAHGLRVMSFIEKSVARLDQLDRLEALALELGKSHYHYNAP---PKYYSYVGAEFICAVQPILKERWTAELEEAWKTMFQFVTSLMNQGYQE 177
468 5.000e-36UniRef50_K0T1L2 Uncharacterized protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0T1L2_THAOC  ali  21  88...EKRKTAIQSTWKTVGDSL-GVEATKLFYKRLFEQYPDVVPMFGDAN-----MDEQAEKLLKTVSLAVEYLKDVPALIPILEDLGAKHAT--DWKVQKEHYDAVGECLLWTLETGLGDAWTGDVAEAWTWVYGVIGSTMSAGEKA 224
469 6.000e-36UniRef50_H6RLL7 Flavohemoprotein n=7 Tax=Geodermatophilaceae TaxID=85030 RepID=H6RLL7_BLASD  ali  20  2.....DIPAMRANFA--KAAATGDEAPLYFYSHLFLSHPETRQMFPVS------MAHQRDRFFAALGDVVTRVDDLDALVPILRQLGRDHLKFG---VLPAHYPAAGGSLLATL-EHFDPEWTPELAKSWAEAYDVVATVMIQGAEE 131
470 6.000e-36UniRef50_A0A0B0H4B5 Hemoglobin-like flavoprotein n=2 Tax=Solemya velum gill symbiont TaxID=2340 RepID=A0A0B0H4B5_SOVGS  ali  17  3.LSQKTIVIVKESIPII--QEHGLEISSRMYDILFEKYPETKALF------SGPIEKQPKILTTAIAAYAENIDQIEKLHDKLMYIANTHVK---SHVLEEHYPMVGDAILLAMKEVLADKATSEILEAWGEAYAYLAEILTMNEKQ 137
471 6.000e-36UniRef50_A0A061N5S4 Flavohemoprotein n=2 Tax=Geomicrobium sp. JCM 19055 TaxID=1460649 RepID=A0A061N5S4_9BACL  ali  19  2.LQEQDIKNVKETAFVFK--EYGREIGERFYETLFDQHPELHNLFNEANQKRG---IQQRALMDSVYKAGIHIDELESLGPMITHVAEKHRALG---VQPEHYEVVGTILLQTVRDVLGTNVTDDVLESWGKAYAVISGQFIEVERE 139
472 7.000e-36UniRef50_A0A1X4N3K0 Dihydropteridine reductase n=1 Tax=Thalassospira sp. MCCC 1A01428 TaxID=1470575 RepID=A0A1X4N3K0_9PROT  ali  21  4SLSPRTIELVKATVPALGA--HGTDITKVMYAKLFQDA-HIRALFNQSNQ--GESGSQVKALAAAILAYARNIDNLEALVPVVERIAHKHIGY---HILPEHYAYVARALIGAIAEVLGDKVNEDILTAWGEAYWFLANILIERE.. 140
473 7.000e-36UniRef50_A0A2N9BB92 Naphthalene 1,2-dioxygenase system ferredoxin-NAD(+) reductase component n=127 Tax=Actinobacteria TaxID=201174 RepID=A0A2N9BB92_S  ali  20  162........LIRRAMAEITPVAD--KVTSYFYALLFVRHPDLRSLFPAA------MDTQRDRLLRALLTAAEHIDNTDVLVDYLQNLGRGHRKYGT---RAEHYPAVGECLIGALSKYAAGVWDAEMEAAWVRTYTTISQVMIDAA.. 287
474 7.000e-36UniRef50_K9WGN6 Hemoglobin-like flavoprotein n=1 Tax=Microcoleus sp. PCC 7113 TaxID=1173027 RepID=K9WGN6_9CYAN  ali  17  111.....DIKVLEVSFALIQPQ--ATEFASKFYKNLFTDYPQLQPLFAYTH-----IEVQEKKLITALVLVINNLRKLTYLKNILKDLGTRHVRYGTIQ---EHYPMVGGTLLKTLESFLGKEWTPEVKRAWTHGYKAIANLMQE.... 238
475 9.000e-36UniRef50_A0A173KSS9 Nitric oxide dioxygenase n=104 Tax=Bacteria TaxID=2 RepID=A0A173KSS9_9SPHN  ali  19  4.LSAETIAIVKATAPALR--SHGVEITTAMYKRLFQ-DPSIKDMFDQGAQDSGE---QPKRLAAAILGYAENIDKLQALQGAVARMVQRHVETG---VKAEHYPKVAEALLPAIRDVLGEEATDAVLNAWGKAYWFLAEILIGKEAQ 141
476 9.000e-36UniRef50_A0A125BCZ6 Flavohemoglobin n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A125BCZ6_THIDE  ali  20  2.LSAETLATIKSTAPLLA--EQGKAITDLFYSKLFAQHPELQHIFNMANQAQGE---QSRALAESVFMYATHIDALQNLGPMVSRIAHKHASL---QVAPEHYPIVGKYLLEAIQDHLGLEPGHPVLGAWAEAYAQLAGIFIKTEE. 138
477 9.000e-36UniRef50_UPI000B912BAA cytoglobin-1-like isoform X1 n=3 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B912BAA  ali  22  42GLTKEQKEHIRKSWAVVCTMK--TKFGVELFAKLFTNYPSSQQHFAQLKDKNPKMRAHGYRVVSAFCSLVENLDTPDIFIELLKNTGYSHS---MRNVPHHYFEELGLVFLEVMSEQLGDKFTPKAKEAWGLAYGFMCKVILGAMDE 191
478 1.000e-35UniRef50_A0A1Y2TJI7 Globin-like protein n=11 Tax=Sordariomycetes TaxID=147550 RepID=A0A1Y2TJI7_9PEZI  ali  19  2.LNYQETKLVKDTLPALKQ--HGEHISTVFYKTMLRDHPELHNYFNTVNMHTGK---QPRALTQLILAFASNIINISELTPKLERVAQKHASL---SIQPEQYEIVGKYLLRAFSAVLGPSMTPDVKLAWTKAYWVMAR-MLTGREA 138
479 1.000e-35UniRef50_A0A0S8BHN5 Uncharacterized protein n=1 Tax=Acidithiobacillales bacterium SG8_45 TaxID=1703383 RepID=A0A0S8BHN5_9PROT  ali  20  1.MTPRQIMLVQATFEQSRTRSRI--IGERFYRRLFTRYPEIRELF------SGDIEDQAGKLIRMMAVLVDSLDRPAETADILFELGIRHQAYG---VRQEHYYAAGRIFLWAIKPADGSPFSPEIKQAWMAFYEMIVRQMIEAPRQ 135
480 1.000e-35UniRef50_A0A172UT76 Hemin transporter n=1 Tax=Mycobacterium sp. YC-RL4 TaxID=1682113 RepID=A0A172UT76_9MYCO  ali  19  10.LEPAHAEIVTATLPLVGA--NIDAITREFYRRLFDAHPSLRNLFNRGNQAQG---AQQRALAASIATFATHLVNPDLPHPALSRIGHKHASLG---ITADQYPIVHEHLFAAIVEVLGDTVTAEVAEAWDRVYWIMAETLIDMERA 151
481 1.000e-35UniRef50_A0A178XDP2 Ferredoxin--NAD(P)(+) reductase (Naphthalene dioxygenase ferredoxin-specific) n=120 Tax=Actinobacteria TaxID=201174 RepID=A0A178X  ali  16  33......VQLIRDTWAKSEPY--APEISQFFYGMLFTLAPATRDFFPI------NMEVQGGRIIRALARVVQMVDRPDDLLPFLRQLGRDHRKFG---VAPKHYEAVGTALLAALKNHLGPEWTPEVERAWAEAFTIV.......... 152
482 1.000e-35UniRef50_UPI000C047112 uncharacterized protein LOC111298175 isoform X5 n=1 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C047112  ali  21  207AFTEEQEALVVKSWNSMK--KNAGELGLKFFLRIFEIAPSAKKLFTFLRDSNPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATHFKYG---VVDEHFEVTKFALLETIKEAVPEMWSPEVKNAWGEAYDQLAAAIKSEM.. 355
483 1.000e-35UniRef50_Q30K44 Ferrisiderophore reductase (Fragment) n=4 Tax=Vibrio TaxID=662 RepID=Q30K44_VIBCL  ali  16  1...........................QHFYQRMFSHNPELKHIFNMTHQKTG---RQSVALFEAIAAYAKHIDNLAALTSAVERIAHKHTSF---NIQPEHYQIVGHHLLETLRELAPDAFTQPVEEAWTAAYFFLAQVFIDRE.. 112
484 1.000e-35UniRef50_Q3SGG8 Flavohemoglobin n=14 Tax=root TaxID=1 RepID=Q3SGG8_THIDA  ali  20  2.LSAETLATIKSTAPLLA--EQGRAITDLFYSKLFSEHPELQHIFNMANQAQGE---QSRALAESVFMYATHIDALQKLGPMVSRIAHKHASL---QVAPEHYPIVGKYLLEAIRDHLGLEDGHPVLGAWSEAYAQLADIFITTEE. 138
485 1.000e-35UniRef50_F0SL04 Methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor n=2 Tax=Planctomycetaceae TaxID=126 RepID=F0SL04_RUBBR  ali  17  4.....DIPQLRDSFGLIAPRAD--QFAKSFYDRLFADHPELRSLF-----AGTSMEDQRQKLIQSLLVTMRSLDQPEKLQPFLQDLGERHREY---NVMPRHYDLVGGALLETLGEYLEESWTPDLAAQWKLAYQTIAQIMV..... 130
486 1.000e-35UniRef50_A0A2G8BUM0 Nitric oxide dioxygenase n=1 Tax=Tatumella sp. OPLPL6 TaxID=1928657 RepID=A0A2G8BUM0_9GAMM  ali  18  2.LTTHQKQLIQQTIPVL--QANGQALTDYFYHRMLSQVPELKETFNMGHQRDGK---QAKALANAVLAYAENIEDPSVLLPVINMICQKHVSL---NIQAPDYAVVGEHLLHSISEVLSVPMEDELISAWAIAYHQLADLMIETEK. 138
487 1.000e-35UniRef50_A0A061NUD9 Flavohemoprotein n=2 Tax=Geomicrobium sp. JCM 19038 TaxID=1460635 RepID=A0A061NUD9_9BACL  ali  18  2.LQEQDIKNVKETAFVFK--EYGREIGERFYETLFEQHPELHNFFNEANQKRG---IQQRALMDSVYKAGIHIDELESLGPMITHVAEKHRALG---VQPEHYEVVGTILLQTVRDVLGTNVTGDVLESWGKAYASIAALFIEAERQ 139
488 1.000e-35UniRef50_A0A261RD21 Flavohemoprotein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A261RD21_9BORD  ali  23  2.LSQEVRTLVKSTAPVLK--THGEALTCHFYARMFQHNPELKQVFNQGHQEGGQQQQALA---AAVAAYAEHIDDPSVLAPVITRIVHKHVSLG---IRPEHYAIVGKHLLASIREVLGEAATDELVAAWAAAYGQLADLLIAEE.. 137
489 1.000e-35UniRef50_UPI0009FE0A5D hypothetical protein n=1 Tax=Algiphilus aromaticivorans TaxID=382454 RepID=UPI0009FE0A5D  ali  19  28..TPRETRLIRESWRNIARDRD--AIVVTFYDLLFRWKPELRGYF------SEDMSEQRRMMAVTLNLAVSHIDRIETIRESVRDLGRRHARYGA---RASYYDLVVEALVRAISQHAGPAFGPRVEAAWRRAFALIAEEMLAGAE. 161
490 1.000e-35UniRef50_A0A0X7JRV9 Uncharacterized protein (Fragment) n=113 Tax=Actinobacteria TaxID=201174 RepID=A0A0X7JRV9_9ACTN  ali  18  41..DSADAVIIRRTLDEIEPMAD--KVTSYFYALLFVRHPDLRALFPAA------MDTQRDRLFKALLTSVKNVDDTAYLTEYLSHLGRGHRKYGTL---PEHYPAVGECLITALARYAATTWGPESEAAWVRAYTKISQIMIDAAAE 174
491 1.000e-35UniRef50_A0A1Q6ZA02 Uncharacterized protein n=2 Tax=Ktedonobacter TaxID=363276 RepID=A0A1Q6ZA02_9CHLR  ali  17  10......VALLQQSFAEVKSQQ--EAFAEAFYRRLFALYPQTIPLF-----ATTNMKRQQSLLMATLELVVAGVTRGDNVIPSVEQLGRRHAIYG---VKAEHYPMVGQALLETFKQFLQDKWTAQVEATWAQAYAMITDLMRRA... 137
492 1.000e-35UniRef50_R7UKY8 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7UKY8_CAPTE  ali  18  20.LTDKDKLLIRRNWKHLAC--NLTERGARVFLRIFVDNPSVKDLFPFKKLQGEELRGHASRFMQAVGAVVDNIDDFEQLAPLLNGLGRKHIDF--HGFTPTHFNAFQDAMLAVWSEDLGGKLTPEGRDAWIKVFGFIMRELKKGY.. 166
493 1.000e-35UniRef50_UPI0009B763A7 hypothetical protein n=1 Tax=Bradyrhizobium elkanii TaxID=29448 RepID=UPI0009B763A7  ali  20  47.....QQELVQTTFARLAAMPEVT--GALFYERLFASNPNFRPLF------RNNMRIQGVKLMTMLAMVVYNLPAQDQLSPAIHDLALRHVEYG---VKLEDYDAMREALLWTLEQALGEDLTPAVREAWTVCYDELAGEMKAAA.. 175
494 1.000e-35UniRef50_UPI000A3A41A6 flavohemoprotein n=4 Tax=Streptomycetaceae TaxID=2062 RepID=UPI000A3A41A6  ali  21  74........LIRRTLAEIEPSADKA--VSYFYALLFLRHPGLRALFPAA------MDTQRDRLFRALLTAARHVDDTATLTEYLSQLGRGHRKYGT---ESAHYPAVGECLIGALAHYARDSWNADAEAAWVRAYTAISQIMIDAAAE 201
495 1.000e-35UniRef50_A0A1Y5TN36 Bacterial hemoglobin n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1Y5TN36_9RHOB  ali  23  3.LTQRQLELVRESFSVLRDDPIPKSI--DFYTSLFRQAPELKAMF------REDLAGQGMRFMATLGAIVDNLHDTKAMADRYADLGRAHRALG---VRAQDFEPMGKALIETLSATLGDAFTPEMQEAWETAYTEFSRDIIA.... 133
496 2.000e-35UniRef50_A0A1M9UA58 Nitric oxide dioxygenase n=43 Tax=Actinobacteria TaxID=201174 RepID=A0A1M9UA58_9MYCO  ali  19  7.LSPAHAEVVKATLPVVGGA--IGEITPVFYRRLFAAHPELRDLFNRGNQANGS---QQKALAGSVAMYATLLVDPDAPADVIERIAHKHASLG---VAPEQYPVVYEHLFAAIVEVLGDVVTADVAEAWTAVYWSMADMLIGRERE 147
497 2.000e-35UniRef50_UPI0007320A96 hypothetical protein n=1 Tax=Thiohalocapsa sp. ML1 TaxID=1431688 RepID=UPI0007320A96  ali  20  1.MNSQTAALVRDSWAALVPMRK--QVCADFYQRLFTRHPELRPLFK------GDLDRQTALFATMLNTVVSSLENREPVVVLIKAVGARHVGYG---VADADYDKFADALLESFALALGERFTPRTRTAWEQVFAELAATMRQGAEE 135
498 2.000e-35UniRef50_A0A1M4N9F6 Uncharacterized protein n=2 Tax=Donghicola TaxID=393277 RepID=A0A1M4N9F6_9RHOB  ali  17  1.MTPFAISLVEETFAKIEPQS--EAFARHFYDDLFASAPEVRPYF-----EGVDTEQQGKKLMAALSALVKGLNDLETTIPMVEELAKRHVAYG---VQPDDYDKVGASLMRTLARALEEDFHQEAEMAWDETYSTMATVMKAAYDE 137
499 2.000e-35UniRef50_A0A1E3PPV8 Globin-like protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PPV8_9ASCO  ali  18  1.MNAAEIVILKSSWQELYSNSATTLFIEQFYDNLISQNPDILILFP-------SIRRQSVAFAGVLSLAISSLDNIEVLDDYLVRLGKRHGR--IIGVDVSHFEMVGNALLDTLRDKLGDGMTIELESAWIRLYSYLANKLLDASED 137
500 2.000e-35UniRef50_A0A070A1K2 Dihydropteridine reductase (Fragment) n=1 Tax=Komagataeibacter rhaeticus AF1 TaxID=1432055 RepID=A0A070A1K2_9PROT  ali  18  5.LDDKTRSIIKACVPALEA--HGLAITTEMYRRLLA-NPDIRDLFNISHQKDGE---QPKALALAVLAYARNIDNLGAMAGTVERIAEKHVGL---NILPEHYPYVADALLGAIAHVLGDAATPDIMDAWGKAYWFLAEILIGREEQ 141
501 2.000e-35UniRef50_A0A1G6VAC4 NAD(P)H-flavin reductase n=2 Tax=Glycomyces TaxID=58113 RepID=A0A1G6VAC4_9ACTN  ali  24  3.....DAERLKKNWSLVA--SHGDQVPLYFYSTLFLTHPETRDLFPM------NMAAQRDKLVNALGAVVSNVDTIDAVVPTLQALGRDHRKFGALR---GHYPAVGEALVATLEHFSGPHWTPAIAADWTAAYGLVSATM...... 127
502 2.000e-35UniRef50_A0A0G4M2N6 Uncharacterized protein n=2 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4M2N6_9PEZI  ali  19 1202..TEAQTAIVKSTAPILK--EHSLTITTVFYKSMLGAHPELHNIFNISNQRSG---AQQKSLANALLAYATHIDELQKLGPAVERIAQKHVSLG---ITPDQYAIVGEHLIKAIATVLGDGLTPEVADAW................. 1321
503 2.000e-35UniRef50_A0A2T7NZ43 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NZ43_POMCA  ali  15  67.LTEEEKRILTESWEII--VHDVEKIGVVTFFGLFETHPDVQDIFIPFKGKSTDLKSHVLRVMGTVEKCLARIHEPAKMESILHELGVKHL---LLNIRVEYLDLIGPQFIKAVRPAMGDLWTPEVESAWANLFRLITHIMKEAM.. 212
504 2.000e-35UniRef50_A0A2R8A7H0 Bacterial hemoglobin n=4 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A2R8A7H0_9RHOB  ali  19  4..DDSDIRLVRKGWATAVAAAD--QTAQSFYANLFRIAPGTRPLF------REDIDVQGRKLVETLDFIVDHLDELDTLLPAARDLAIRHTAYG---VQTEHYDHVGTALITTLQDLLGRDFTDEDQAAWTRVYGTLSGQMIAA... 134
505 2.000e-35UniRef50_C5BEV3 Oxidoreductase, FAD-binding protein n=1 Tax=Edwardsiella ictaluri (strain 93-146) TaxID=634503 RepID=C5BEV3_EDWI9  ali  18  2.LDTQTIVIVKSTLPLLQQY--GPGLTAHFYQRMFRHNPELKSLFNMSHQHSGD---QREALFNAICAYAAHIDTPAALSGAVERIAHKHVSVG---IQPQQYAIIGHHLLKTLEELFNPG--SDVLDAWSNAYSTLAQLFIARE.. 135
506 2.000e-35UniRef50_A0A0L0K1T6 Flavohemoprotein n=26 Tax=Streptomyces TaxID=1883 RepID=A0A0L0K1T6_9ACTN  ali  21  9.......................DKVTSYFYALLFVRHPDLRPLFP------PAMDAQRDRLLKALLTAAEHVDNTPVLVEYLQNLGRGHRKYGT---RPEHYPAVGECLIGALAKYAQSVWNPETEAAWVRTYTTISQVMIDAA.. 121
507 2.000e-35UniRef50_UPI0006B0D012 globin C, coelomic-like n=2 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D012  ali  21  24GLTPREKQNIRKTWAIV--QKNVKENGVELFIRFFDAHPDYIKLFKPLLRSSKRLEAHALSVMYAITSLVDSLDDVECLKELLLKTAHNHAHRG---VQGEQFDHLTIIILKFLRDGLGSSFTPPVGEAWEKAFNVMNEIIKQGLKE 172
508 2.000e-35UniRef50_A0A1L6LK91 Adenylate cyclase n=1 Tax=Minicystis rosea TaxID=888845 RepID=A0A1L6LK91_9DELT  ali  25  351...ADDVREVTASFARIAPRSD--DLAARMYERLFERHPHLRRLFP------TDMTAQRRKLVGSLVVIVDNLRRSDRLFPLLEDLGRRHAAYG---VKVEHFEAVGQALLGAIAD-LDEQLDQKARAAWENAYASIASAMRRGLE. 481
509 2.000e-35UniRef50_A7ICZ3 Globin n=17 Tax=Rhizobiales TaxID=356 RepID=A7ICZ3_XANP2  ali  21  1.MHDDQIGLLETSFAELSTDRDAA--AALFYERLFVLDPALKRLFG-----DTDMAGQGQKLFAALDLVVASLRHLDKVVPVLEQLAVRHVHYG---VRDAHYATVGAALIETLSLYFGPRFSMELRRAWSDAYEVVAGVMIAAA.. 134
510 2.000e-35UniRef50_A0A1C2HST2 Uncharacterized protein n=2 Tax=Thioclava sp. SK-1 TaxID=1889770 RepID=A0A1C2HST2_9RHOB  ali  17  1.MDHKQIMLVRTSFDQV--IKSRPELVEDFYTRLFVLHPELRPLFPAS------ISAQADKLTATLQIALSSLDQLEGLTQILQDMGRMHRGYG---VQDHQYQMVSEVLIDTLAAQLGSAWTVEVSAAWGTLLAFVTYEMIVGA.. 133
511 2.000e-35UniRef50_Q81T23 Flavohemoprotein n=521 Tax=Terrabacteria group TaxID=1783272 RepID=HMP_BACAN  ali  25  2.LSEKTIEIVKSTVPLL--QEKGVEITTRFYEILFSEHPELLNIFNHTNQKKG---RQQQALANAVYAAATYIDNLEAIIPVVKQIGHKHRSLG---IKAEHYPIVGTCLLRAIKEVAGAP--DEVLNAWGEAYGVIADAFIS.... 133
512 2.000e-35UniRef50_A0A1H2HBP4 NAD(P)H-flavin reductase n=10 Tax=Jiangellaceae TaxID=1217100 RepID=A0A1H2HBP4_9ACTN  ali  17  95.......EALRESMALVE--DHLEAVGVDFYAQLFAIAPEARDLFGAG------MAVQRSRLVGALVRIVGNADDREVLAPYLEGLGRDHRKFG---VIDQHYAPVGTALVLAIRRALGDAWTPRFEKAWVDAYDMIASIMAGAAR. 222
513 2.000e-35UniRef50_A0A2N3I060 Globin n=1 Tax=Raineya orbicola TaxID=2016530 RepID=A0A2N3I060_9BACT  ali  21  1.MTPNQAEIVKKSFPKILAGTLSA--THILYDKLFELSPDTRDLFKKT-----SMERQSQMLIAAIGKLVKSIDNWDTVKPDLEALAKRHAGYGLS---PEHFVYFGHAFIHMLKSMYGNEWNTDLEESWKAVYQKISEVMI..... 131
514 2.000e-35UniRef50_A0A165G3Z1 Oxidoreductase FAD/NAD(P)-binding domain protein n=1 Tax=Exidia glandulosa HHB12029 TaxID=1314781 RepID=A0A165G3Z1_EXIGL  ali  18  16.LTTEQRALVTATVPVL--LEHGSEITRLFYATLLGENPELKNTFNLAKQQQGK---QADALARAVLAYAQNIDDPTPLLPVVERIAHKHASL---HILPQQYAIVGKYLLEAITQVVGDVFSGALYDAWGAAYWQLAHIFIGREAQ 154
515 2.000e-35UniRef50_UPI0006B09B77 neuroglobin-like n=2 Tax=Chelicerata TaxID=6843 RepID=UPI0006B09B77  ali  20  39.LTSNQIALLTNTWKLL--VENISRVGVIAFMNLFETHPDVQEVFLPFKRYNKELRAHALRVMGFVQKVMARLNEEEKMDQLLADLGRKHIYYGA---KPEYIDWIGPQFVNAIRPSLEAHWTAEIEEAWCQLFRYVAWVMKTAM.. 184
516 2.000e-35UniRef50_UPI000B794C43 non-symbiotic hemoglobin 1-like isoform X1 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B794C43  ali  22  88GFTEEQEALVVKSWNSMK--KNSGELGLKFFIKIFEIAPSAKKLFSFLNDSNPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATHFKYG---VVDEHFEVTKYALLETIKEAVPEMWSPEMKNAWAEAYDQLAAAIKIEMK. 237
517 3.000e-35UniRef50_A0A1H0SZL4 Nitric oxide dioxygenase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0SZL4_9ACTN  ali  20  1.MSPSSSETVRATAGVVA--ENGDQITALFYASMLADHPELLRLFNKGNQATGE---QPRALAASVVAYAGSLIDPDAFHHVMQRIAYKHVSLG---IKPQQYTIVGHYLLGAVGEVLGDAVTPQIAEAWNEVYWLFATQLIAEE.. 138
518 3.000e-35UniRef50_A0A2M9AL56 NAD(P)H-flavin reductase n=11 Tax=Streptomyces TaxID=1883 RepID=A0A2M9AL56_9ACTN  ali  20  1.MDANER--IRASFARVERRAD--HVAKYFYSHLFARNPGVRELFPA------DMSEQRDRLFAALTHVVQRLDDPD-LPRYLATLGRDHRKFDA---RPEHYAAVGESLIAALRFGLPNTWDEETEQAWLGAYKVLSEAMIGGSEE 132
519 3.000e-35UniRef50_A0A2E8EB56 Flavohemoprotein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E8EB56_9BACT  ali  18  44.....EVQLLRDSFVALTPRH--GELLQTFYDTLFERYPQVRPLF-----AKNDMSEQRKNLGEAPALVVANLERPDVLTQTLHRMGARHVAYGA---EPPHYDAVGECLLHALAVTAGPLWNDELADAWAGAYGAVADLMKQGAAQ 175
520 3.000e-35UniRef50_UPI000B795192 plastid division protein PDV2-like isoform X2 n=1 Tax=Hevea brasiliensis TaxID=3981 RepID=UPI000B795192  ali  22  382GFTEEQEALVVKSWNSMK--KNSGELGLKFFIKIFEIAPSAKKLFSFLNDSNPKLKPHAVTVFVMTCESAVQLRKAGKVESSLKDLGATHFKYG---VVDEHFEVTKYALLETIKEAVPEMWSPEMKNAWAEAYDQLAAAIKIEMK. 531
521 3.000e-35UniRef50_A0A2G3K4S2 NO-inducible flavohemoprotein n=7 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2G3K4S2_9BURK  ali  20  2.LSQTARPYIDASVPVLR--EHGAAITTQFYTTLFEDHPELMHIFNMGNQANGS---QQQSLAAAVYAYAANIDNAAALTPVLTRITHKHASIG---IKPEHYPIVGRHLLAAIQTILGEAATPALLAAWDEAYGLLATQLIAMEKQ 139
522 3.000e-35UniRef50_Q6N3I5 Globin-like protein n=11 Tax=Rhizobiales TaxID=356 RepID=Q6N3I5_RHOPA  ali  20  7.LSPADIHRVRTSFDLMWPRS--TEMADQFYARLFEIAPDSRTLFRS------DMTRMKDKFIQTLAVLVGSLDNLTGLYAVAGKLAVDHVRYG---VRPDHYAPVGEALLWSLGQQLAGFWNDDVEQAWRRVYAVISARMIGAA.. 139
523 3.000e-35UniRef50_A0A1Y5DTY5 Uncharacterized protein (Fragment) n=1 Tax=Methylophaga sp. 41_12_T18 TaxID=1856284 RepID=A0A1Y5DTY5_9GAMM  ali  20  47.....ETELLEDSFAALAPQ--GEQLATRFYERLFDKYPETVPLF-----EDIPIKGQEKKLLASLVLLVQNLHKPEVLAEYLQGLGARHVHYG---VTAEDYPKVAENLLAVMAEFAGDLWTAEVKTAWEKTLNTVAMIMLKAYQ. 177
524 3.000e-35UniRef50_A0A1C2HNM9 Uncharacterized protein n=1 Tax=Thioclava sp. SK-1 TaxID=1889770 RepID=A0A1C2HNM9_9RHOB  ali  20  1.MTPEQIAHVQDSFRRIQPMSD--TVATVLYADLFTHSPKLKPMFTGL-----DMAHQGQQLMRAIGHVVANLSTPQAIWPMARTVAVHHAKCG---VNPGDYDVFGTGLLRTLDRALGDAFTPEAKTAWIEAYSMLVGVMIKAA.. 134
525 4.000e-35UniRef50_A0A143BNN0 Uncharacterized protein n=1 Tax=Gemmatimonas phototrophica TaxID=1379270 RepID=A0A143BNN0_9BACT  ali  27  2NLSAE--RIIRESWATLVPMRALA--AQLFYTRLFEIDPSAKLLF-----DGKPMYVQHEKFLQTIDTLVQMLDYPPQIIEELQALSRRHVGYG---VVVAHYETVGAALLWALEQGLGDQWNADVKRAWTELYLFISGVMTRTA.. 134
526 4.000e-35UniRef50_UPI00031F3E87 NO-inducible flavohemoprotein n=5 Tax=Enterobacterales TaxID=91347 RepID=UPI00031F3E87  ali  18  2.LDTQTIVIVKSTLPLLQQY--GPGLTAHFYQRMFRHNPELKSLFNMSHQHSGD---QREALFNAICAYAAHIDTPAALSGAVERIAHKHVSVG---IQPQQYAIIGHHLLKTLEELFNPG--SDVLDAWSNAYSTLAQLFIARE.. 135
527 4.000e-35UniRef50_A0A0T9KLQ3 Monooxygenase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0T9KLQ3_MYCTX  ali  22  2.....DAQRLKDNFDHVAGQGD--AVALFFYSDLFVRNPHLRDMFPVG------MSGQRDKLLRALGHIVARVDDLPTLVPFLRQLGRDHRRFG---IIAEHYPHVGASLLATLRHFTGDDWTDDVESDWNAAYSLAAKVMLEAAEA 132
528 4.000e-35UniRef50_UPI0006B0D619 non-symbiotic hemoglobin 2-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI0006B0D619  ali  19  22NLTPRQVELVRETWTLLSV--DMTATGIFIFNRFLTDYPELCDLFPFVSIANDGLERHALGVMQALEGAVNNLENTQLLSTILFDLGQKHARY---NVEESMLDKLWRSLRGSLKEALQEKMTDEVEHAWFCVFRFVARQMIDGMR. 170
529 4.000e-35UniRef50_A0A0B4BES3 Uncharacterized protein n=1 Tax=Leisingera sp. ANG-Vp TaxID=1577896 RepID=A0A0B4BES3_9RHOB  ali  19  8...AAEAALVQESFA--AATALGDALTLEFYQRLFEWAPQVRPMFP------DDISGQAQVLGKTLAFAVNGLKHPEDLAAPLQKLGARHAGYG---VEPAHYAVVADVLIETLQSNLKDTWTSAHEKAWRGALDLVAKVMIAG... 137
530 4.000e-35UniRef50_UPI0003F065FF neuroglobin-1-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F065FF  ali  16  25.FTERQRRIVRKTWRPLA--NDMTGNGTKVFLHIFEMNPKVKQLFPCRDKTGEELKGHASRFMQSVGAAVDNLDNLESLAPLLMNLGKSHNHF--SGFELNYFDSFTGAMLHVWELELQDRFTPEVMEAWKLVFDYMMGKMKDGY.. 171
531 4.000e-35UniRef50_A0A1Y2J482 Uncharacterized protein n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2J482_PYCCO  ali  20  17.LTPDQRKLISATVPILA--EHGVTITKLFYKQMLDANPDLRNVFSHSKQQRG---HQAEALARAVYAYATNIEDLTPILPVVERIAHKHTS---VHIVPSQYAIVGKHLLEAITQVVGDVFRGDLYNAWAAAYWNLAHIFIDRERQ 155
532 4.000e-35UniRef50_UPI000690F9F4 flavohemoprotein n=1 Tax=Kitasatospora azatica TaxID=58347 RepID=UPI000690F9F4  ali  16  12.......ALIRASLAVVEPY--AADLPVFFYATLFNRYPQVRELFP------PDMDVQHDRLLRALLMIVELVDDPENLVRFCSHLGRDHRKFGTLS---AHYDAVGECLLATLAHFAGAAWTPEIAAAWTRAYTTVAEV....... 133
533 4.000e-35UniRef50_A0A2W6E4M4 Flavohemoprotein n=1 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6E4M4_9PSEU  ali  19  32.......EAITHTFSLVNQAGDRA--VAYFYGRLFAENPELRPMFPAA------MDAQRDRLFHALTRIVHGLSSPEAMEPYLSQLGLDHRKYG---VLTEHYPAVGRALLATMGRFSGDAWTPGAEAAWAGAYERATQLMTAAAD. 159
534 5.000e-35UniRef50_A0A240UQA8 Nitric oxide dioxygenase n=3 Tax=Halomonadaceae TaxID=28256 RepID=A0A240UQA8_9GAMM  ali  13  2.LNEKQLEVINATAPVVAA--NAETIASTFYPLLFERYPQVRSMFNMRHQATGE---QPRALARSVVAYALNRQDPVALERLMHPIVNKHV---AINLQPDQYAIVAECLMAAIGEVLGDAVTPEIADAWSGLYWEFADRLMAAEEN 139
535 5.000e-35UniRef50_A0A1M3G2Z4 Uncharacterized protein n=1 Tax=Sphingobacteriales bacterium 46-32 TaxID=1895839 RepID=A0A1M3G2Z4_9SPHI  ali  21  1.MTTEQVRLIRETWEVLRGV-NPYLVADVFYRRLFMEHPGLRRLFP------DEMDQQYGKLMDMLNMLVERLDQLDDLADDIADLGRRHVHYG---VKPEYYNAVARALLWTLEQALEDSWSGEAEQAWTDCYLQLAGQMQAGM.. 134
536 5.000e-35UniRef50_A0A239V744 Nitric oxide dioxygenase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A239V744_9MICO  ali  19  2.LSAPSATIVKATAALVA--EHSTHITTQFYSDMFHDHPELTNIFNMANQAIGE---QPKALAASVVAYATHLISPDAFAPVLRRIAHKHVSLG---ITAPQYTIVGHYLMQAIGKTLGEALTPDIAAAWNEVYWLFATQLIAEE.. 139
537 5.000e-35UniRef50_UPI0008D21D70 NO-inducible flavohemoprotein n=1 Tax=Rosenbergiella nectarea TaxID=988801 RepID=UPI0008D21D70  ali  17  2.LTSQQKKIIQQTIPILKA--NGTVLTDYFYHRMLSQVPELRETFNMGHQRDGK---QAKALANSVLAYAENIDDPSVLLPVITMICQKHVSL---NIQAPDYSIVGEHLLHSISEVLSVPMEDELIGAWGAAYQQLAALMIDTEK. 138
538 6.000e-35UniRef50_A0A1E4K1G6 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4K1G6_9GAMM  ali  25  5.....DIQRVRESYAAI---GDGSGLGQRFYAQLFRLRPDARALFPV------DLDQQVHKLIDMLASIVRALDAPAQLARDFAELGRRHLGYG---VSEEDYDDVGAALLMALREQLGTAFTPEIEQAWATLYGDLAEAMIAAENA 134
539 6.000e-35UniRef50_A0A177HLN4 Flavohemoprotein n=36 Tax=Streptomyces TaxID=1883 RepID=A0A177HLN4_9ACTN  ali  20  8......................ADKVTSYFYALLFVRHPELRSLFPAA------MDTQRDRLLKALLTAAEHIDNTDVLVAYLQNLGRGHRKYGT---RPEHYPAVGECLIAALTRYATNTWDDETEAAWVRTYTTISQVMIDAAAE 123
540 6.000e-35UniRef50_A0A2K0U5J4 Uncharacterized protein n=1 Tax=Gibberella nygamai TaxID=42673 RepID=A0A2K0U5J4_GIBNY  ali  21  17.....QIKIVQSTIPALE--KHGVEITTLFYRQLLNKHPELNNIFNTAHQDTGE---QPAALAHAVWAYAVNIENPEAMKAAISRIGHKHVSLG---VTADQHPIVGQGLLSAIKQILGDGVNSKVLDAWDTTYRKLAEYFIN.... 146
541 6.000e-35UniRef50_A0A1D9BFE1 Uncharacterized protein n=1 Tax=Jeongeupia sp. USM3 TaxID=1906741 RepID=A0A1D9BFE1_9NEIS  ali  19  2.LAPDHRATITATLPVVAA--NATAISGRFYERMLGAHPELRNVFNQGNQASGE---QKQALAGAVYAYAQHCDHPAAIEPLLNRIAHKHASLG---ISPDMYTIVGRHLMAAIGEVLGDAVTAGIAEAWDTVYWRFAGELIARE.. 137
542 6.000e-35UniRef50_UPI0002B46EBE flavohemoprotein A-like n=1 Tax=Hydra vulgaris TaxID=6087 RepID=UPI0002B46EBE  ali  17  12.LSESSIRLLKSTSAILSTE--GTKVTSRMYEIMLSNYPIVKNLFNTSHVNSNTVAPQAQALANAVFRFAANADNLTALQDMLKLIAHKHVSF---NILPEHYPIVGNCLLRAIKDVLQDAVTNEVMEAWREGYDYLADLFIK.... 152
543 7.000e-35UniRef50_A0A0B6YIN5 Uncharacterized protein n=4 Tax=Mollusca TaxID=6447 RepID=A0A0B6YIN5_9EUPU  ali  20  22.LTARQLELVQDTWDVMKQ--DLPTLGLTVFVKLFQTEPDLKRLFPKIVQMNEKLQRHAVTVMEGLGAAVESLDDSDFLNSVLVSIGQTHVR---RSVKPQMLRRLWPSLNHGFEKILGEQYTKETMEAWRRLYNYIIFQMKKGMQD 173
544 7.000e-35UniRef50_A0A1I6WLE6 Nitric oxide dioxygenase n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A1I6WLE6_9RHOB  ali  18  5.LSEATLQIIEATAPVVAQ--HVDQIVPAMYRRLLADE-EIRALFNMSNQEG--QAPQHKALANALVAYATHIRTPNVLAEAVERIAQKHAGL---QILPEHYPHVADALLGAISEVLGEAATPEILSAWGEAYWQLAHILIGREED 142
545 7.000e-35UniRef50_UPI0009EF1312 flavoprotein n=1 Tax=Gordonia sp. LAM0048 TaxID=1633223 RepID=UPI0009EF1312  ali  21  4......REVLQDSLSLVIDDEH--TLMLDFYDRLFEEHPEVRPLFG------PDLRPQATMLQQAIAAVIDHLDDAEWLGRTLGALGRRHADLG---ITPEMYGWVADALIETMAEAGGEEWTADMTAAWTEALGAVAGLMLDAY.. 131
546 7.000e-35UniRef50_A0A022RUM2 Uncharacterized protein n=4 Tax=Erythranthe guttata TaxID=4155 RepID=A0A022RUM2_ERYGU  ali  20  66AFTEEQEALVTKSWNIMK--KNASELGLKFFLRIFEIAPSAKKLFSFLNDSNPKLKPHAITVFVMTCESAVQLRKAGKVTSTLRDLGTTHFKYG---VADEHFEVTKYALLETIKEAVPEMWSPEMKCAWADAYDQLVAAIKLEM.. 214
547 7.000e-35UniRef50_W7S8R2 Nitric oxide dioxygenase (Fragment) n=1 Tax=Kutzneria sp. 744 TaxID=345341 RepID=W7S8R2_9PSEU  ali  18  2.LSSSSATIVAATLPAVRAA--AVDISTTFYAGMFAEHPALLDLFNRGNQANGD---QQRALAGAVIAYAESLLSGVDVDPVVRRIAHKHASLG---IRPEQYTIVGRHLLSAVARVLGPAVTPAVETAWDEVFWLFAVRLIAAE.. 137
548 7.000e-35UniRef50_UPI00030B2123 hypothetical protein n=1 Tax=Spirulina subsalsa TaxID=54311 RepID=UPI00030B2123  ali  17  242......VSILEESFRLLKQ--HSDQFTDVFYTCLFEKIPESRAMF-----TQTDMTKQKQKLWGSVELVYENLRRPELLSGALKGLGATHVQYG---IESQHYQRAGEVFLETCATCLGTAWTPDVQEAWADAYATIQALMLQGAES 372
549 8.000e-35UniRef50_C1EC08 Uncharacterized protein n=2 Tax=Eukaryota TaxID=2759 RepID=C1EC08_MICCC  ali  23  5...PNHVQEVENSWNKVAALG-VENVGVLLFKNIFTIAPEALELFSFRNEPNLTLKAHGVNVVNTVGKAVAGLREFYTLVPALAALGERHVEYG---ILEPHYDVVGKALLMTLEQGLGDAFTPQVKEAWTIVYEAVAVTMK..... 143
550 1.000e-34UniRef50_A0A2N3ULT4 NAD(P)H-flavin reductase n=5 Tax=Streptomyces TaxID=1883 RepID=A0A2N3ULT4_9ACTN  ali  22  106..TPRDLELIAATLAAVEPVADRA--TAHFYALLFLHYPQLRSLFPAA------MDVQRDRLFRALLLAARGVGDPVALTAQLGALGRGHRKYGTL---AAHYGPVGECLLAALARYAGGRWDAEAELAWRRAYRMVSQIMIDAAEQ 239
551 1.000e-34UniRef50_A0A2E9FW34 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E9FW34_9RHOB  ali  21  1.MTKEEILAVQQSWRLLMNRMD--EIGEKFYENLFEEVPMFETLF------TEEKAKQGSKLMNLIGLTVTKL-HLEKPDQTISTVGKRHIAYG---VKPEYFAKFGEVLMKTFKDALKNNWTPELESAWTKAYANMAALMVKAYEE 134
552 1.000e-34UniRef50_K1RJ02 Nacrein-like protein F n=1 Tax=Crassostrea gigas TaxID=29159 RepID=K1RJ02_CRAGI  ali  17  389SLSEDQLELLEKSWNSIKV--NIANIGVVAFMNLFQTHPEVKDAFLPFQQLAEDLRSHALRVMGTVDKCLTRIRTPEKLQSLMHELGERHVNYSAKY---DFIDMVGGQFVHAIKPHLQDSWSEELGEAWVQLFRVLCYYMKKGMRD 537
553 1.000e-34UniRef50_A0A167EK10 Yhb1p n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167EK10_9ASCO  ali  23  4GLTSQQVEHIKAGVPLMEQAGD--AFLSEFYAKMISENPALLNVFNKTHQRTLD---QPRALTRAVVAYAKNIDNLGVLSPVVERIVQKHCSL---NVKAEHYPIVGKYLLDAISVKFGPDATPAFLDAWAAAYGQLAELLIGAEK. 142
554 1.000e-34UniRef50_A0A1E4K2T0 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4K2T0_9GAMM  ali  23  1.MDPASIALIRANFAMIAGDADG--FAADFYARLFTLAPQVRPMFGN------DLAEQRAKLVRMLSMLIAGLDRPEQLAGPLANLGQRHAGY---QVQSHHYAVVGAALLDTLAARLGAAFDDAAHTAWATLYGGVAATMQR.... 131
555 1.000e-34UniRef50_A0A136P213 Globin n=1 Tax=Chloroflexi bacterium OLB13 TaxID=1617414 RepID=A0A136P213_9CHLR  ali  18  3SLTEHDKKLVQRSFTHIAPQN--EDIAAVFYARLFELDPDIEHLFSTG------LDVQRAKLMRMMADLVNALDAPEALSQSMRELGKQHVSYG---VHDKHYATVGEALIWALRKVCPAVMTPTVTQAWEKTYALFAELAISGA.. 136
556 1.000e-34UniRef50_A0A0V1PQ05 Uncharacterized protein (Fragment) n=1 Tax=Debaryomyces fabryi TaxID=58627 RepID=A0A0V1PQ05_9ASCO  ali  17  14.LTTREKELINASLPILE--ESGEILTSQFYTNMLADFPEVRPFFNESDQRT---MKQPRILAFALLNYAKNIDELAPLTAFVNQIVVKHVGL---QVKPEHYPIVGKCILDTMKSLLGPGATEEFLTAWATAYGNLAQMLINAEAE 152
557 1.000e-34UniRef50_A0A251X5F9 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X5F9_9GAMM  ali  18  3.LSENTQRIVKNSVPLL--QAHGHEIAQRTYAILFEKYPQTQPLFSRT------VPEQAQRLAGVIIRYCDNIDQLEVLHQALDDIAQRHA---AADVHPGHYPMLGHSLLQAVKEVLGAEANDELVNAWKEAYFYLADILIEKER. 136
558 1.000e-34UniRef50_K9V3H3 Nitric oxide dioxygenase n=42 Tax=Cyanobacteria TaxID=1117 RepID=K9V3H3_9CYAN  ali  17  3..SQKTIEIVKATAPIIK--EKGEEITLRMYQITFEERPDYKRSFENTWMQHLDGGGQAGKLAASVYAYATHIDRLDQLATAVGKIAHRHV---EARILPEQYPLIGEKLLQAMRDVLQDNGTDEVIAAWAEAYEALANIFIQAENA 142
559 1.000e-34UniRef50_A0A1Y2WZU6 Uncharacterized protein n=2 Tax=Hypoxylaceae TaxID=2033035 RepID=A0A1Y2WZU6_9PEZI  ali  19  2ALNYKESKLVKDTLPSLRQ--HGEHISTVFYKTMLRDHPELHNYFNTVNMHTGK---QPRALTSLILAFASNIVNISELTPKLERVAQKHASL---NIQHEQYEIVGKYLLRAFSAVLGPAMTPEVKMAWTKAYWVMAK-MLTGREA 139
560 1.000e-34UniRef50_M7TXL9 Putative globin-like protein n=2 Tax=Xylariales TaxID=37989 RepID=M7TXL9_EUTLA  ali  21  2SLSYQEAKLVKGTIPALK--EHGEHIATVFYKTMLRNHPELNNYFNSVNMQNGS---QPRALTSLILAFASNISHISELIPMMERVAQKHTSL---NIQAEDYDIVGKFLLRAFAAVLGPAMTPDVRLAWTKAYWLMSRML...... 134
561 1.000e-34UniRef50_UPI000BB56270 hypothetical protein n=1 Tax=Agaribacterium haliotis TaxID=2013869 RepID=UPI000BB56270  ali  19  2.LSPSTIEVVKNTVEVVR--EHGTAITGEFYRSMFEAHPELTNLFNMSNQIKGE---QKQALASAVYAYAANYDNAALLNPILNRIAHKHASLG---IQPAQYTIVGKYLLAAVKTVLGDAVTDEVAVAWDEVYWQLACDLISREAQ 139
562 1.000e-34UniRef50_UPI000C04D831 non-symbiotic hemoglobin 1-like isoform X6 n=3 Tax=Durio zibethinus TaxID=66656 RepID=UPI000C04D831  ali  21  85AFTEEQEALVVKSWNSMK--KNAGELGLKFFLRIFEIAPSAKKLFTFLRDSNPKLKPHAMTVFVMTCESAIQLRKTGKVESSLKDLGATHFKYG---VVDEHFEVTKFALLETIKEAVPEMWSPEVKNAWGEAYDQLAAAIKSEM.. 233
563 1.000e-34UniRef50_A0A2V1AIR1 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AIR1_9ASCO  ali  19  13.LTTAQKELIKASVPILETS--GLDLTKTFYNSMLSGNPEVRPFFNDTNQIT---YRQPKVLAFALLNYAKNIDDLTPLTDFVNQIVVKHVGL---QVRAEHYPVVGSHLIATMGKLLGEKATPEFVEAWSIAYGNLAQLLIDAE.. 149
564 1.000e-34UniRef50_UPI000DAC3124 globin n=1 Tax=Rhodobacteraceae bacterium DSL-40 TaxID=2219044 RepID=UPI000DAC3124  ali  20  15ALTEKDIRIVQESLPAIRA--HLEPASMKFYENLFKIAPELRPLF------REDLAGQGMKFFSTLNTVFDMLHEPKTADAEMSDLAGSHATLG---VKASHFAPMREALRVTLEETLGADFTPEMSEAWLKAYDEVADGMIARA.. 148
565 1.000e-34UniRef50_A3RQ92 Flavohemoprotein / Dihydropteridine reductase / Nitric oxide dioxygenase n=193 Tax=root TaxID=1 RepID=A3RQ92_RALSL  ali  16  2.LSEQSKPLIDASVPVLR--EHGLTITQTFYRNMFASHPELTNLFNMGNQANGS---QQQSLASAVFAYAANHGNNAALAPVVGRIVHKHAAVG---IRPSHYPIVGRHLLGAIAEVLGDAATPALLAAWDEAYW............ 127
566 1.000e-34UniRef50_UPI0005EDA302 uncharacterized protein LOC100889989 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EDA302  ali  28  309.LRAREQELVQKTWGVLS--LDTEQHGAAMFAKLISAHPAVAQMFPFGENQNPTLRAHGKRVMETIGQTVGSLDDLDILVPILRDLARRHVGY---SVTRQHFEPVGEALMHAIQEGLGRSFSEEVERAW................. 439
567 2.000e-34UniRef50_A0A059ITZ4 Uncharacterized protein n=2 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A059ITZ4_9RHOB  ali  19  2SLTAREAALVRASFRSVRDRVEPA--SRDFYAALFRRRPDLRGLF------RGDLEGQGMKFMSTLQVVVDTLEAPEATAGRLHDLGRSHAALG---VRPAHFEPMREALFEVLAGYLGGGWDAETRGAWHRAYDQMVERMIAA... 134
568 2.000e-34UniRef50_UPI00076FDDE3 hemoglobin-2 n=1 Tax=Neodiprion lecontei TaxID=441921 RepID=UPI00076FDDE3  ali  18  22GLTGKQKRLVTETWGIMRQ--DPMKLGIAVMMRLFTKHPEYRSQFHAFKDKNKRFQAHASAIANALSTIIDSLKDPGLLEAILISLGEKHHKRGQ---TVEQFNNLKLVLLVVFKEFLGSRWTPEVNNAWSKALDFVYSIIFKVY.. 168
569 2.000e-34UniRef50_A0A239CRT9 Nitric oxide dioxygenase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A239CRT9_9ACTN  ali  19  2.LSDRSRPVIEATLPVVA--EHVGEIAQRFYAHLFGAHPELFDVFNRGNQATGE---QQVALAGSVAVFASTLQTPEQLPELLSRIAHKHASLG---ITPAQYDVVHEHLFWAIADVLGDAVTPEVAAAWDEVYWLMAYALINQER. 141
570 2.000e-34UniRef50_A0A061DX38 Hemoglobin 1, GLB1,NSHB1,ATGLB1,HB1 n=4 Tax=malvids TaxID=91836 RepID=A0A061DX38_THECC  ali  20  85AFTEEQEALVVKSWNSMK--KNAGELGLKFFLRIFEIAPSAKKLFKFLRDSNPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATHFKYG---VVDEHFEVTKFALLETIKEAVPEMWSTEMKNAWGEAYDQLAAAIKNEM.. 233
571 2.000e-34UniRef50_A4BR57 Flavohemoprotein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A4BR57_9GAMM  ali  24  3..SAQEIEVIKSTAPLLA--THGKDITGRFYQLLFEQNPELSNVFNMSNQRSGN---QQQALARAVYAFAAHVDNLPAIAGEVERIAQKHASLG---VIAEQYPLVGAALLQAIEQTLQPP--AEVLDAWAKGYGVLAGVFIEREAQ 137
572 2.000e-34UniRef50_A0A1E3R1S2 Hemin transporter n=2 Tax=Dietzia alimentaria TaxID=665550 RepID=A0A1E3R1S2_9ACTN  ali  18  18.LSEEHAAVVRATLPVIGA--HIDEITPVFYRTMFADNPELRDTFNRGNQ---KLGAQQRALAASIATFASLLVDGRSPVDMLSRIGHKHASLG---ITPDQYQVVHDYLFGAIVEVLGEAITPEVAAAWDEVYWIMAAVLVDFEKA 156
573 2.000e-34UniRef50_A0A0P6B1R4 Neuroglobin n=5 Tax=Daphnia magna TaxID=35525 RepID=A0A0P6B1R4_9CRUS  ali  27  89.LTDLQKTLLQQSWKRLEM--DIAQVGIIVFINLFESHPDMQSVFPFTGLVLDDLKEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRHDKNGA---KLEYIDYIGPQFLSAIRPILGGDWTAETEKAWTLLLGYMIATMKQAL.. 234
574 2.000e-34UniRef50_A0A2P1PMX0 Uncharacterized protein n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PMX0_9GAMM  ali  20  56.LSKTDHPILKHSLSNVA--SDPAAFAGRFYANLFAAMPGLRVLFPA------DLSEQQMKLAQTLAMVVSGLDESDAMVPLLRRLGAAHRGYGT---KPAHYQVVGDVLIKTLSDTCGPDWNDDLERSWQRLYQWVAANMI..... 185
575 2.000e-34UniRef50_UPI00035D6A41 hypothetical protein n=1 Tax=Methylobacterium sp. WSM2598 TaxID=398261 RepID=UPI00035D6A41  ali  22  1.MNPDAIAIIRFGFRHLAAEPD--HLAVNFYARLFDLGPSLRPLFN------DDLTRQGRKLVAMLAQVVQGLDRLGTIVADVRALGRRHVGYG---VVPAHYATVGAALLSTLADRLGATFDAEARSARTQAYTLLAEVMLEASRE 135
576 2.000e-34UniRef50_A0A2W4LBT9 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4LBT9_9PROT  ali  19  3..TDAQKQAIKKSWKLVVPI--AETAADLFYKRLFELRPEYRRLFG------DDMTSQKRKLIRMLAFIVKSLDWSDALLLVILALGRRHSEL--YKIPDESYDVVGEALLWTLDYGLGDAFTSEVRDAWAHVYTLLASAMKMA... 145
577 2.000e-34UniRef50_V4SH90 Uncharacterized protein n=6 Tax=Spermatophyta TaxID=58024 RepID=V4SH90_9ROSI  ali  19  70AFTEEQEALVVKSWNAMK--KNSGELALKFFLRIFEIAPSAKKLFTFLKDSNPKLKPHATTVFVMTCESAVQLRKAGKVESNLKDLGATHFKYG---VLDEHFEVTKYALLETIKEAVPEMWSPEMKNSWAEAYDQLAAAIKTEMK. 219
578 2.000e-34UniRef50_B9RZD8 Non-symbiotic hemoglobin, putative n=5 Tax=fabids TaxID=91835 RepID=B9RZD8_RICCO  ali  22  385AFTEEQEALVVKSWNSMK--KNAGELGVKFFLKIFEIAPSAKKLFTFLRDSNPKLKPHAMTVFVMTCESAVQLRKAGKVESNLKDLGATHFRYG---VVDEHFEVTKFALLETIKEAVPEMWSPDMKNAWAEAYDQLVTAIKNEMKS 535
579 2.000e-34UniRef50_A0A0M0EDG7 Flavohemoprotein n=36 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M0EDG7_KOMEU  ali  18  5.LDDKTRSIIKACVPALEA--HGLAITTEMYRRLLA-NPDIRDLFNISHQKDGE---QPKALALAVLAYARNIDNLGAMAGAVERIAEKHVGL---NILPEHYPYVADALLGAIAHVLGDAATPDIMDAWGKAYWFLAEILIGREEQ 141
580 2.000e-34UniRef50_Q6WZ20 Neuroglobin n=9 Tax=Cercopithecinae TaxID=9528 RepID=NGB_MACMU  ali  22  7.......ELIRQSWRAVSRS--PLEHGTVLFARLFALEPDLLPLFPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVG---VKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDS 150
581 2.000e-34UniRef50_A0A1U7IU07 Uncharacterized protein n=1 Tax=Phormidium ambiguum IAM M-71 TaxID=454136 RepID=A0A1U7IU07_9CYAN  ali  19  4.....QVEVLQETFQQIK--EHTDEFAVSFYENLFHDYPHFQSLF-----ARTNMTEQHKHLVRALMLTIENIRDQETVHDALEQLGARHVRYGALQ---EYYPDFCATLLKTFASSLGEKWTTEVEQAWIEAFEAISQLMLKGAE. 134
582 2.000e-34UniRef50_A0A1R4G3V6 Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) n=34 Tax=Actinobacteria TaxID=201174 RepI  ali  24  3......IEMLKSTWADMSQAGDEAPL--YFYSHLFITHPELREMFPVS------MASQRDKLFGALGHIVSNVEKLDSDTGFIEELGRDHRRF---AVEPEHYSAVGSSLLATLKQFLGSQWTESVAADWSAAYGQIAKIMV..... 127
583 2.000e-34UniRef50_A0A137NSM0 Globin-like protein n=76 Tax=Fungi TaxID=4751 RepID=A0A137NSM0_CONC2  ali  18  60..SARQIELVKATAPVLANR--GVEITTHFYKNMLGDNPELKNLFNLTHQATGAQAAALA---HAVWLYADNIDNLDGLKSAISRIGNKHASLG---VKPDDYSIVGKYLLFSIKSVLGDSIDDETLESWKEAYKQLAGVFIKTE.. 194
584 2.000e-34UniRef50_M1VB93 Uncharacterized protein n=1 Tax=Cyanidioschyzon merolae (strain 10D) TaxID=280699 RepID=M1VB93_CYAM1  ali  21  50...QESIAIVQSTWSQAVQQR--ERLGQVFYDRLFALYPELQPMFRS------DPALQRIRLVDMVDAGVKLLNSRRDLEQALRDLGKRHVKYGT---QEEQYPIVGENLLHALESILGSKFSEDMRKAWLDVYAYWSSVMLEGARE 183
585 3.000e-34UniRef50_Q9NPG2 Neuroglobin n=125 Tax=Amniota TaxID=32524 RepID=NGB_HUMAN  ali  21  7.......ELIRQSWRAVSRS--PLEHGTVLFARLFALEPDLLPLFPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVG---VKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWD. 149
586 3.000e-34UniRef50_A0A0Q5V1H4 Uncharacterized protein n=5 Tax=Sphingomonadaceae TaxID=41297 RepID=A0A0Q5V1H4_9SPHN  ali  19  2SLTADQVRLVTESYALIGCSPRP--YSELFYHRLLLDHPFARALFP------DDLRHQAFVFEKTIAILVREVGNIAGLRPTLADLARKHVGYG---VRPYQYEAVGAVLIATFSEILGSRFTPEIREAWETVYAETAGVMIAEA.. 135
587 3.000e-34UniRef50_A0A239E1V7 Hemoglobin-like flavoprotein n=3 Tax=Actinomadura TaxID=1988 RepID=A0A239E1V7_9ACTN  ali  25  6.........LKDNFALVGA--NGVDVAEYFYADLFARAPRLRSMFPAS------MAKQHEVLLAALSQIVSSVDDPDALVPFLRDLGRRH---GGFGVTADHYAPVGASLLSTLAHFSGPAWSADLERDWTAAYGVVAQVMTEAAAE 132
588 3.000e-34UniRef50_A8LLN0 Putative flavohemoglobin n=1 Tax=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) TaxID=398580 RepID=A8LLN0_DINSH  ali  18  1.MTQDEITLIQRSFSRIFAQK--ARFGALFYERFFALNPEARAMF------QTSITRQSEMLIEALALVVRGMRTDGALPPKALQMAARHGRYG---VTPDHYAQMGEALMDTLAEVLGDAFDTETREAWQRAYGRLSE........ 127
589 3.000e-34UniRef50_A0A157SS23 Flavohemoprotein n=33 Tax=Bacteria TaxID=2 RepID=A0A157SS23_9BORD  ali  22  2.LSATVRELVKSTAPVLK--THGEALTRHFYARMFQHNPELKQVFNQGHQQSGQQQQALA---MAVAAYAEHIDDPSVLGPVLERIAHKHVSL---SVRPEQYAIVGKHLLASIREVLGDAATDELIDAWAAAYGQLVDVLV..... 134
590 3.000e-34UniRef50_A0A1Q8ZF79 Uncharacterized protein n=2 Tax=Leptolyngbya sp. `hensonii` TaxID=1922337 RepID=A0A1Q8ZF79_9CYAN  ali  19  2.....QAHLLESSLAQIESRR--EEFSARFYEHLFTLRPDVQPLFSKTN-----MAEQQRMLMSALYLIVRNCQKPTLFGPMLQGLGSRHIGYGTEG---DCFPDMGRALVATFAEYLGDQWSADLETAWLTAFGEISRHMLAGVKQ 133
591 3.000e-34UniRef50_A0A0A0DTI6 Flavohemoprotein n=24 Tax=Bacteria TaxID=2 RepID=A0A0A0DTI6_9BURK  ali  20  2.LTQTHRELVKGTAALLK--EQGVALTRHFYARMFEYNPELKAIFNQGHQREGS---QQQALAMAVAAYAQHIDNPGVLMPVLELIANKHVSLG---IRAEHYAIVGRHLLASIREVLGALATDELIEAWGAAYGQLADVLV..... 134
592 3.000e-34UniRef50_UPI0009E516CE neuroglobin-like n=2 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E516CE  ali  22  22.LSTKEKCLVRNSWGLIKM--NSTLVGKTIFLRLFHMKPDLPKLFPELKITSGQLDAHAERVMRAVENAVSALDDAESFTAYLEELGRRHK---VRALKPDYLEAMHKAFMWTLNDLLHSTWNSDTADAWSKLFLFVCDVMIRGLRS 169
593 3.000e-34UniRef50_A0A1W2G989 Hemoglobin-like flavoprotein n=2 Tax=Reichenbachiella faecimaris TaxID=692418 RepID=A0A1W2G989_9BACT  ali  17  1.MTTQEISTIKSCWEVIAP--NGILVAQKFYKELFESKPEYRRLF------TGDMDKQAEKLMMTLGFLMANLDRMSTIKKSVEDLGKLHANH--FKVLPEYYPPVKVALISSIAYYMEEDWTQTHHNAWDKLINSVATMMINGA.. 134
594 3.000e-34UniRef50_E4NEB0 Putative oxidoreductase n=6 Tax=Streptomycetaceae TaxID=2062 RepID=E4NEB0_KITSK  ali  21  6.......AVIRASFAVVERRAD--QLTKFFYAHLFTNNPGVEELFPA------RLAEQRDRLFAALTQLVTRLEEPEKLTGYLAALGRDHRKFQAA---PEHYPAVGASLIAALKHFSGHSWTQEVEKSWLEAFTVISQAMIDAA.. 132
595 3.000e-34UniRef50_R7URJ5 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7URJ5_CAPTE  ali  21  95.LTDRQMTLIEDTWSIV--QRDISTVGLDMFSRMFEAFPGIKESFPEDHRYRKEISEHGVRVLNTVDTILRLRHDPDKTIETLHDLGGKHISFNA---KVDYIDLLGQHFLFAMEPVLKQHWTPEVEQAWADLFRLMSHVMKEGM.. 240
596 3.000e-34UniRef50_UPI0006F39086 hypothetical protein n=1 Tax=Sphingomonas sp. Leaf20 TaxID=1735685 RepID=UPI0006F39086  ali  24  34SLTADQIRLVRESYALISRS--PTRYSDAFYYRLLLDHPFARALFP------DDMAHQIAVFSKSIDALVENVVDLGRLHPELSALALRHVQYG---VKPYHYAVIGAVLIDTFADILADCFTPATREAWEAVYAETAGVMIA.... 165
597 3.000e-34UniRef50_V4ABF4 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V4ABF4_LOTGI  ali  16  1......MDLVRETWNI--AREDIARVGVVAFLSLFEKYPETQNIFLPFRQHSARLREHGLRVMLTVEKCIARLDKPEKLQDLLHDLGQKHVEFNT---KVDYIDMVGPQFIQAIRPVVKSDWTPEVEDAWEDFFKLLIYFMKEAM.. 141
598 3.000e-34UniRef50_A0A1D4INB4 Flavohemoprotein n=312 Tax=Bacteria TaxID=2 RepID=A0A1D4INB4_STASA  ali  17  2.LNEQEKAIIKETVPVL--QERGIEITSFFYNRMFTQHPELRNMFNQTNQKKG---LQSTALAQSVLAAAMNIEDLTKILPVVKEIAYKHCAL---QVPASGYDIVGENLLAAIQSVLGLEEDDVIVQTWGKAYGEIASVFINIEKE 139
599 3.000e-34UniRef50_A0A1W0WNA7 Uncharacterized protein n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WNA7_HYPDU  ali  21  71.LTHEQKAMIRESFEVLKQT--VGDVGVVFFMRLFETHPEVQDVFPFQGLSQEDLRNHGLRVMGFVEKCVARLEQPEKLVALCLELGARHAKY---QVPAPYLLLIPPQFIYAIKPALNDKWSAEMEAAWGTLFRIAIYYM...... 212
600 4.000e-34UniRef50_A0A258GJE5 Globin n=1 Tax=Rhodobacterales bacterium 32-67-9 TaxID=1970560 RepID=A0A258GJE5_9RHOB  ali  19  4..TTRQAELIRQSFETLQQRLGPA--SMVFYEALFRRAPQLREMF------RDDLAGQGMKFMTTLGTIIVNLDDPDAQGDKFAELGRGHA---LIGVKASHFAPMGAALIETLRDELGADFTPDLEAAWQAGYDELAARIIR.... 133
601 4.000e-34UniRef50_A0A0B6YLQ8 Uncharacterized protein (Fragment) n=4 Tax=Gastropoda TaxID=6448 RepID=A0A0B6YLQ8_9EUPU  ali  21  1........................KVGVVMFIKLFETHPEVQNVFVPFKQDSTQLKSHALRVMGTVEKCVTRFQDPERIRQMLHELGARHVMYNA---KVDYMDLIGPQFIWAIEPVIGDRWTPEVEQAWSDLFKYISYIMKDAM.. 125
602 4.000e-34UniRef50_A0A0T9KLG1 Oxidoreductase FAD-binding subunit n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0T9KLG1_MYCTX  ali  24  8.........LKDNFALVGA--NGVDVAEYFYADLFARAPQLRSMFPAA------MARQHEVLLAALSQIVSSVDDPESLVPFLQDLGRRHRGFG---VIAEHYAPVGASLLATLAYFSGPAWSEDLERDWTAAYGVVAKVMTEAAAE 134
603 4.000e-34UniRef50_UPI000349B039 hypothetical protein n=1 Tax=Oscillatoria sp. PCC 10802 TaxID=1173028 RepID=UPI000349B039  ali  15  5......VEALERSLERVKPWGD--EFAVSFYDNLFICYPEVKPLF-----AKTEMNKQYKKLVNDLVLVVENLRNPEALGEVFDTLGARDVEYGALAI---HYPAVGDALLATFEQYLQEDWTPEVKQAWEDALAAIAAQMLK.... 131
604 4.000e-34UniRef50_H6L2T7 Globin n=2 Tax=Saprospira grandis TaxID=1008 RepID=H6L2T7_SAPGL  ali  15  1.MNQEDIRLVQASVPILE--EHAETLTRLFYKNMLSNHPELKNIFNLANQA---LGQQQKSLALSVLAYAKHIEQPEVLLPALELIGHKHRSL---QVQADQYPIVGKYLLGALQELLDLPDDAPILGAWGRAYQQLADILIE-MEA 137
605 4.000e-34UniRef50_A0A0F5W5F7 Flavohemoprotein n=44 Tax=Streptomycetales TaxID=85011 RepID=A0A0F5W5F7_9ACTN  ali  20  2..............AEVAPVAD--KVTSYFYALLFVRHPDLRSLFPAA------MDTQRDRLLKALLTAAEHIDNTPVLVDYLQNLGRGHRKYGT---RAEHYPAVGECLIGALSKYAENIWDPELEAAWVRTYTTISQVMIDAA.. 121
606 4.000e-34UniRef50_A0A239HGU4 Nitric oxide dioxygenase n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A239HGU4_9SPHN  ali  21  5.LSPVTVAIVKSTAPALQQ--HGVEITTRMYERLF-VDPAIKAMFDQAAQESGE---QPKRLAGAILAFAQNVDKLEALTGAVDRMARRHVETG---VKAEHYPVVAAALLPAIRDVLGAEATDEVLAAWAEAYGMLADILIGRE.. 140
607 4.000e-34UniRef50_A1T5C2 6,7-dihydropteridine reductase n=43 Tax=Actinobacteria TaxID=201174 RepID=A1T5C2_MYCVP  ali  22  10.LEPAHAEIVTATLPLIGA--HIDEITKEFYRRMFGAHPELRNLFNRGNQAQG---AQQRALAASIATFASHLVDPELPHPALSRIGHKHASLG---VTADQYPVVHEHLFAAIVAVLGDTVTADVAAAWDRVYWIMADTLIA.... 147
608 5.000e-34UniRef50_A0A2T6AXA3 Nitric oxide dioxygenase n=1 Tax=Roseivivax pacificus TaxID=1267769 RepID=A0A2T6AXA3_9RHOB  ali  17  2.LPEETKTRIRGTIARLTCY--PQDLAYGFYDRLFERAPETRALFK------DDIGSQADKLMDTLMVVVQSLDKLAGLVTFVEALGRQHARHG---VTDDMYPVVGDVLIDTVAENV-EDWSDADRAAWYELYNYLSDLMITGARD 135
609 5.000e-34UniRef50_UPI0009E50D0A globin C, coelomic-like isoform X1 n=3 Tax=Scleractinia TaxID=6125 RepID=UPI0009E50D0A  ali  23  21NLTDDQKNVIKKTW--ITIEENRTKIGKQTFIRVFELNPQIKKMMPEFMTADPKLFGHSKTLMTCLENAVKSLDDNERFVAYLVELGRRHQ---VRPLKAPYFEVIHEALMFSLKDVFQSDWTTETSESWSALFRYMSEAMIIGLND 170
610 5.000e-34UniRef50_P39676 Flavohemoprotein n=81 Tax=cellular organisms TaxID=131567 RepID=FHP_YEAST  ali  18  2.LAEKTRSIIKATVPVLEQQ--GTVITRTFYKNMLTEHTELLNIFNRTNQKVG---AQPNALATTVLAAAKNIDDLSVLMDHVKQIGHKHRAL---QIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAWGEAYQAIADIFITVEK. 138
611 5.000e-34UniRef50_A0A2M8WP56 Nitric oxide dioxygenase n=3 Tax=Yoonia TaxID=2211641 RepID=A0A2M8WP56_9RHOB  ali  23  1.MTPNQIETVKDSFQQIYPVH--EALSATFYDELFRIAPSVRPFF------AEDMTEQRVKLSETLGAVVNNLHQLPLIADTVIGLARRHVSYGA---KPEHFAPVGHALIFALEKHMPGGLTEVETDAWVAAYTQISDLMTEAM.. 133
612 5.000e-34UniRef50_D7G3H0 Globin, putative n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G3H0_ECTSI  ali  20  547.....TVETVKTSWQKVLDRFGFQDIADSFYSVLFEVEPSVESLFTRSK------RFHGEMLMRMVDTSVRLLNNLQELVPDLLQLGLRHNAY---KVRKEHFPVVGEALIATLGLVLQNEFTDEVKQSWAAVYNLLSNIMISVLD. 678
613 5.000e-34UniRef50_A0A2W2BKA1 Flavohemoprotein n=2 Tax=Jiangellaceae TaxID=1217100 RepID=A0A2W2BKA1_9ACTN  ali  20  126.......EALRETLSLVE--DHLESVGVDFYAQLFTIAPEARELFGAG------MAVQRSRLVGALVRIVGNADDRETLVPYLEALGRDHRKFG---VIDQHYAPVGTALVLAVRRAVGDAWTPRHERAWIEAYDKIAAIMSGAAR. 253
614 5.000e-34UniRef50_F6EYW1 Nitric oxide dioxygenase n=76 Tax=Bacteria TaxID=2 RepID=F6EYW1_SPHCR  ali  18  4.LTADTIAIVKATAPALR--KHGVEITTAMYARLFEDA-SIKDMFDQAAQESGE---QPKRLAAAILGYAENIDRLQALDGAVARMVQRHVETG---VKAEHYPKVAEALLPAIRDVLGAEATDAVLDAWGQAYWFLANILIGREAQ 141
615 5.000e-34UniRef50_A0A1E5P946 Flavohemoprotein n=1 Tax=Streptomyces agglomeratus TaxID=285458 RepID=A0A1E5P946_9ACTN  ali  20  6....................EDAGKVTSYFYALLFTRHPELRSLFPAA------MDTQRDRLLKALLTAAEHIDNKPVLTEYLRNLGRGHRKYGT---QASHYPAVGEALLGALARYATNTWDDEAEAAWIRTYTAISQIMIDAAAE 123
616 6.000e-34UniRef50_UPI0002C33079 plastid division protein PDV2-like n=1 Tax=Fragaria vesca subsp. vesca TaxID=101020 RepID=UPI0002C33079  ali  21  288GFTEEQEALVVKSWAAMK--KNSAELGLQFFLKVFEIAPSAQKLFSFLKDSNPKLKTHAMSVFVMTCESAVQLRKAGKVTSTLKRLGGVHFKSG---VVDEHYEVVKFALLEIIKEAVPEMWSPEMKSAWGEAYDQLVAAIKLEMK. 437
617 6.000e-34UniRef50_A0A2C9JQU3 Uncharacterized protein n=3 Tax=Euthyneura TaxID=216307 RepID=A0A2C9JQU3_BIOGL  ali  18  52.LTAETREIILASWEIIK--KDIERVGVVMFMGLLE-DPDVKGTFMDFRDASTALRSHVLRVMGAVEKVVARMDSEDKVVTLLHDLGQRHVVYNA---RPEFLDLVGPQFNTAIQPALGDRWTPEVEQAWADLFRYITHLMKETM.. 196
618 6.000e-34UniRef50_A0A1G4K575 LANO_0F00254g1_1 n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1G4K575_9SACH  ali  22  2.LSQETCDTVKATVGVLEQ--HGTTITSVFYHNMLSEHEELKNVFNDTNQTRG---VQSTALAATVLAAAKSIENLETLLTQVVQIGHKHRAL---QVKPEHYPIVGKYLLGAIKEVLGDAASPEIMNAWAEAYDAIAKILISVE.. 137
619 6.000e-34UniRef50_A0A1R3HY75 Globin n=1 Tax=Corchorus capsularis TaxID=210143 RepID=A0A1R3HY75_COCAP  ali  21  987AFTEEQEALVVKSWNSMK--KNSAELGLKFFLRIFEIAPSAKKLFTFLKDSNPKLKPHAMTVFVMTCESAIQLRKAGKVESSLKDLGATHFKYG---VVDEHFEVTKFALLETIKEAVPEMWSPEMKNAWGEAYDQLAAAIKTEMK. 1136
620 6.000e-34UniRef50_A0A0P5J1V4 Neuroglobin n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5J1V4_9CRUS  ali  27  50.LTDLQKTLLQQSWKRLEM--DIAQVGIIVFINLFESHPDMQSVFPFTGLVLDDLKEHALRVMGAVQRAVHRLEEPEKLHAFLSDLGRRHDKNGA---KLEYIDYIGPQFLSAIRPILGGDWTAETEKAWTLLLGYMIATMKQAL.. 195
621 6.000e-34UniRef50_A0A2P4ULE5 Flavohemoprotein n=6 Tax=Actinomadura TaxID=1988 RepID=A0A2P4ULE5_9ACTN  ali  25  2.....DAQRLKENFARVA--EQGDAVALFFYSDLFVANPHLRDMFPIG------MTGQRDKLLRALGLIVSRVDDLPELVPFLQQLGRDHRKFG---IVAEHYAPVGASLIRTLKYFSGSYWTPELEADWGAAYGVVAQVMQEA... 129
622 6.000e-34UniRef50_UPI000A02A7F1 hypothetical protein n=1 Tax=Nocardia concava TaxID=257281 RepID=UPI000A02A7F1  ali  23  52......IEALQSSWQQVEAI--GPEAVEYFYNHLFEAHPEVRGMF------AEDLAPQRERFLAGLARIVTNVETLADDPSFVQQLGAHHARLG---VVADHYPVAGASLLATLEHFLGDGWTPELAQTWTAAYGAVVDLMLSA... 178
623 6.000e-34UniRef50_A0A067C6K2 Uncharacterized protein n=6 Tax=Oomycetes TaxID=4762 RepID=A0A067C6K2_SAPPC  ali  19  3.LSADTIRLVKATAPVV--GEHGYAITSQMYSTMLPSDPKISALFNPTHQPGESRARQPIALADAVAAYANNIDNLGALTAAVERIAHKHVSL---EILPEHYDVVGTHLLAAIQTVLGDAATPEIVAAWAEAYGFLADVCIAREKA 146
624 6.000e-34UniRef50_UPI000D6C0BE6 hemin receptor n=1 Tax=Roseicyclus mahoneyensis TaxID=164332 RepID=UPI000D6C0BE6  ali  18  1.MTPKQVELVETSFKAFVPV--AYQTTEDFYESLFRVSPHLRGLFPK------DMQGLRKKLVETLTYVVNGLRYPDALLPVVRDLGRRHKGF---RVEPGYYALVSAALIESMERAMGTAFGPEVKQAWKACITFLATEMITAGEA 135
625 7.000e-34UniRef50_X7F9A6 Uncharacterized protein n=1 Tax=Roseivivax isoporae LMG 25204 TaxID=1449351 RepID=X7F9A6_9RHOB  ali  23  1.MTPEQLELVTESFRRTFAGKTP--VARAFYDRLFAEHPELRPLFPQ------KMAAQYEKFTDTLVFVVRHLARRATVLVSAEELGQRHRAYG---VRPEHYAIVGQALLAAMAEVTPGGLSPAERAAWDAAYALVSDRMRA.... 131
626 7.000e-34UniRef50_UPI000B3EFDEE non-symbiotic hemoglobin 1-like n=1 Tax=Herrania umbratica TaxID=108875 RepID=UPI000B3EFDEE  ali  20