current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: TM0011 TM0011 281892 Purified-2004-02-02, from T.maritima

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MRMAKVKSLEELMKIKEQALKDLQLRGETGKRGKITVAMGTCGIAAGAKETLKAIVEALNEYNINDIAVVQSGCMGLCEVEPTVEVRLEGQEPVIYGRVTPENAKRIVKMHILEGRVVEDLVVKRGEALast
1 -44.700[C] COG3411 Ferredoxin  ali follow..  23  166PNLDKLALYQDLRDIYVLGKKPIPFSKNPLKHSYISVCTSTRCPSRKWQPTFDALKSAVENAGL-DIEVRTSGCLEVCQLGPVVFYSNDR---TWYTRVNPNVAENIVNEHLIKGNKITENLYPPQT. 289
2 -31.600[C] COG1905 NADH:ubiquinone oxidoreductase 24 kD subunit  ali follow..  12  60.AIHAIADVLGIPDVEGVATFYSQIFRQPVGRHVIRYCDSVVCHITGYQGIQAALEKKLQTTFDGRFTLLPTCCLGNCDRGPTMMIDDD-----THSYLKPEEIEKLLEQY................. 171
3 -29.000[S] COG5469 Predicted metal-binding protein  ali follow..  13  2......................TTDNSLGVAEHTLFVCKGKRVGESGGQKLLNQLQQLAQEWELDKFPIQEVECMSACNRSCVVAFTGKGKLTYLFGDLAVDDHASAVLECAGKYYDKADGLLPWSE. 115
4 -28.500[C] KOG3196 NADH:ubiquinone oxidoreductase, NDUFV2/24 kD subunit  ali follow..  17  90.AMHKVAEILQLPRVYEVATFYTMFMRKPTGKYHIQVCTTTPCWLRGSDDILETCKKQLDTTKDRKFTISEVECLGACVNAPMVAINDD-----YYEDLTSKDMQDILNDLKADKIS........... 207
5 -17.000[O] COG4759 Uncharacterized protein conserved in bacteria containing thioredoxin-like domain  ali follow..  10  119........TSGFLEYPNDLDQFQTYQQPKNHIREIMVCTDVACSRFG-YPIYQNLRQNYAAKSAGQLRVWRCSHIGGHQFAPTLFDLPTG---QFWGHIEPEILDVLVWRNSPVKQLRQFY....... 231
6 -9.880[S] COG4273 Uncharacterized conserved protein  ali follow..  12  1.....MRKMVEKVDMEKLPKFLPLCHKEAENLDIIFTCSGAASVGKIGHEVGVLLTKALDIGRRARRVIVIDGCPMKCATKVIFTITDFGIAKQPTLDISEEDVLKVALA.................. 134
7 -9.560[S] COG4844 Uncharacterized protein conserved in bacteria  ali follow..  18  2...............................NPMIEFCVSN--LAHGSQEARAILEKD------PNLDVLEYGCLSYCGESLFALVNGE-----VVMGETPAELVENIYTFIEENPMF.......... 78
8 -8.870[P] COG0155 Sulfite reductase, beta subunit (hemoprotein)  ali follow..  18  398LIVAGVPE-KDKARIEALAREHLMDDNVTSQRENSMACVSFPTCPLAAERFLPEFVTRVEGILQEHIVLRVTGCPNGCGRALLAEVGLVGKAVGRYENITADEILLITDQLV................ 536
9 -7.230[O] KOG0908 Thioredoxin-like protein  ali follow..  15  10....................................................SHFQAELAQAGIQLVVVDASWC-GPCKRAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQYRNRTKIDRVQ...... 91
10 -6.770[OC] COG0526 Thiol-disulfide isomerase and thioredoxins  ali follow..  13  10FLAFSGGFFCASAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGISLVEVDCTEEGDLCSE-PTLNVFKNGKQISQYGPRKHDALVKYMRKQL................ 127

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.