current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [G] COG2706 3-carboxymuconate cyclase, from VFDB

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
1 -4.720PB023339 Q8A4U7_BACTN/1-171 PB023339; Pfam-B_23339;  ali follow..  1MKTTVLFRMMVLVAMVVAGIANTEL------------------AQDNNFITNEEKVDDLVVSKVIYRLDGSLYRHMKYD-------FTYDDQKRVTAKEAFKWDSSTDYAYSSNEITLVYARWNNSHRASVYELNDANMPIAYMNYKWND-GNWAMNIQTPVTDE...................................................................................................................................................................... 164
3 -2.960HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  10  5..........................................LNTNKQFMV-----GNGILAFAVIFVVVIFVYMSMRLQQQKAENRNFIETYTITLTKGFAGDSTSIF----NDSLLVNRTMTEEPFILEVKRFAEQSALMIVNNATEKLSLFELSEQGGEYRFEKEGEEVKTGAGIKKLS-----------KECCQTLSTF................................................................................................................................ 147
4 -2.730PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  12  1MKKVLVALTMVMGMGSAVAFAQEPVQDKFTKITVKELPQVVKSTLSKDY--AFVAEKENGKVYKIIVTAI------KEDQSTEEITVLLNEKGEPV........................................................................................................................................................................................................................................... 107
6 -2.430PB001030 Q6D4H5_ERWCT/1-146 PB001030; Pfam-B_1030;  ali follow..  11  67.....................................................................................................................................................PIHCYQPARREAIK-------AIMRWSGPRMLLRHPILAIRHLIDDHRPVPDYPKRETSAKTSTGRTARLATQRATSADSDADKVK................................................................................................ 145
7 -2.350HGC00106 gi|162841414|dbj|BABA01003295.1|1.0 TMP01000;  ali follow..  2...............................................................................................................................................................................................................EDGDFVKLSNLTTLPIRNNKYMKSLRVYVSGNNLFCITGYSGLDP----ELDISNVQAPGVEYRDTYPTTRSFTFGVNIGF........................................... 81
8 -2.310PB029229 gi|150007903|ref|YP_001302646.1| hypothetical protein BDI_1263 [Parabacteroides distasonis ATCC 8503]gi|149936327|gb|ABR43024.1| conserved hypothetical protein [Parabacteroides distasonis ATCC 8503]  ali follow..  1MKTGIRVTVYALLAMILFSCEHKELCF--------HHPHMVTLRVDFDWKNAPQADPEGMCVYFYPEEGESPIRFDFAGKDGGSVEI---KEGRYILCYNNDTESLLFRGMEGFDTHEGYTRPAKGSEDERVVICPD--MMWGSCA--RNVEITELGLSYECISFADKDKVEWIESSEHVITLYPAELICTYTYEVRNVKNMEYMTQACGSLSSMAPSMLFANEELDRECVTETELHLESSKM------TGKFYTFGHHEENA.................................................................... 263
9 -2.290PB039305 _Gut.Meta.Jp.0057508_ gi|162726131|dbj|BAAY01002830.1||2 (- 1092:1581~0 complete)  ali follow..  3LDGFEAVGEKTTTNKMTMTVMESSVRFSKGVTEALGCPAYVKLNDKQKKIAVQACDAXDENAIKFCKTKRSKADGVDSDAAGKASSVTVRTT............................................................................................................................................................................................................................................... 96
10 -2.260HGC00711 gi|162743779|dbj|BAAZ01020484.1|1.0 TMP00907;  ali follow..  29.............................................................................................................................................................................................................ERGAGTVLVVGVIAVL---------AAALGVSGLIQAQAAAGRSRAAADLAALGGATALSSIVAPGDPCEAASRVARANGAEVTTCSVTGEDVVVEVSVEARVLGVSRPAVSSARAGPV....... 139

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 7 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. VISSA: a program to visualize structural features from structure sequence alignment. Bioinformatics. 2006 Apr 1;22(7):887-8. Epub 2006 Jan 24.