current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG3682 Predicted transcriptional regulator, from VFDB

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MHITAAEAHVMEALWRRSPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPLISHFAQHRPLKPDEVAKLKKLIDEMGELast
1 -5.720PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  8.QLAENKLVLLYIFDRVQPLANIQLTQFIMENDIMNYFMLQQFIGELKESSFIMEQEKDTGQLFMITDQGKKTLTYFISRI....................................... 88
2 -4.360PB000821 Q82P27_STRAW/1-209 PB000821; Pfam-B_821;  ali follow..  13  79VQLSRLLHLVASSV--DGSRDIETIAHRVSGRREVSADNVRYLIQKLDPLGVTVPEGREEE........................................................... 140
3 -3.950PB001025 Q1QFV3_NITHX/1-288 PB001025; Pfam-B_1025;  ali follow..  18  20PDLKTAMLGRIRADEPRKVWTPSDFVDL-------SRDAVDKTLQRLTKAEALRRIDRG---LY........................................................ 74
4 -2.640HGC00422 gi|163631722|dbj|BABG01004545.1|2.0 TMP00397;  ali follow..  11  24.....................................................................RDWLKSQPPEEILHHTYEYTVREDIVMAMEQLELTDAQAQALLD....... 67
5 -2.550PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali follow..  11  27.EYDKALKLAEELPEQFFPETATWGLCWHEIKWGLPVQENLSYQER-------------RQAIYEKRDYHSPMTPYIMERYLENATGFTVHHPNVFKAFFNGDGTLDSKKVRKLIDKLK. 146
6 -2.220PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  36.TTSNLKDKYKRLVKGTDGKNIESVLMQHIEKVEEAQVEVEKVHKRLDI-GMVRYNDMGSDLSYSYALLDENNNGMIITGIYGRSETVTYAKPVKDGKSNYSLSVEELQALQRAKENTID 168
7 -2.150PB019388 gi|83589066|ref|YP_429075.1| Radical SAM [Moorella thermoacetica ATCC 39073]gi|83571980|gb|ABC18532.1| Radical SAM [Moorella thermoacetica ATCC 39073]  ali follow..  12  1.............................................RADEFGYLFLDRPPYQVLASSAITYEEMLRHAIEGLLKYYGNSHLADHAFAYLAATAFDGSYFAIYEALAAWWEA 76
8 -1.980PB053359 gi|153891307|ref|ZP_02012332.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]gi|151582630|gb|EDN46158.1| conserved hypothetical protein [Opitutaceae bacterium TAV2]  ali follow..  12  12..........................................................GRSIAYRCGAFQLLAQMALRRELPEGVAPAQVRGALTAVIR..................... 52
9 -1.870PB038401 Q8RFH0_FUSNN/1-210 PB038401; Pfam-B_38401;  ali follow..  11  6CSIPTGEFLVGDPLVYLGSKYEKEYFQKIPKASDGDCDRYAAVRLKFNDNEISYFEEAMKGIEDLKDINEGDFFGFNVDAGLACICDKKLHDLYCEFDEKFVKENPDGNAYDDYFAD... 133
10 -1.860PB005684 gi|160884252|ref|ZP_02065255.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]gi|156109991|gb|EDO11736.1| hypothetical protein BACOVA_02230 [Bacteroides ovatus ATCC 8483]  ali follow..  22  466.................DEFTRTQLLE-EAVAMGIKENTALTWLKRLTKHGKLISMDG.............................................................. 505

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.