current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG0218 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MELNTHNAEILLSAANKSHYPQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKLLast
1 -105.000[R] COG0218 Predicted GTPase  ali  100  1MELNTHNAEILLSAANKSHYPQDELPEIALAGRSNVGKSSFINTMLNRKNLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL 195
2 -78.600[R] KOG2486 Predicted GTPase  ali follow..  35  112.DAQVVQADYVKSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDTTPPWIMTSSVTNQGRDEILLHMAQLR 312
3 -32.700[R] COG3596 Predicted GTPase  ali follow..  21  39.........................PVIGIMGKTGAGKSSLCNALFAGE-VSPVSDVAACTRDPLRFRLEHFMTIVDLPGVGESGVRDTE------YAALYREQLPRLDLILWLIKADDRALATDEHFYRQVEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQ-LFQPVHPVCAVSVRLQWGLRVMAERMIKCL 216
4 -31.000[R] COG1084 Predicted GTPase  ali follow..  15  159.....................DLDAFTVVIAGFPNVGKSTLLRTLTGAE--PEVADYPFTTKGIQIGHLWKRIQVIDTPG--LLDRPVEDMNNIELQAMVALENIADV--IMFIFDASETCGYTLESQYSLYLGFDIPVVTVFNKMDLAENVKYLEEYINMVE--------DPLKVSAFEGRGVSKIIKKLEGLY 325
5 -30.200[E] COG4917 Ethanolamine utilization protein  ali follow..  18  1........................MKRIAFVGSVGAGKTTLFNALQGNYTLAR------KTQAVEFNDKG----DIDTPGEYFNH---------PRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLD--IGVSKRQIAVISKTDMPDA----DVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLT 146
6 -29.900[R] COG1160 Predicted GTPases  ali follow..  22  212.....................QDKNIKIAIVGRPNVGKSTLTNRILGEDRVV-VFDMPGTTRYIPMERDGQQYTLIDTAGVRKRGKVHLAVEKFSVIKTLQAIQDANV--VLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAY 385
7 -28.100[R] COG1159 GTPase  ali follow..  21  11...........................IAIVGRPNVGKSTLLNKLLGQK-ISITSRKAQTTRH--HTEGPYQAIYVDTPGL-----MEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPD-DEMVLNKLRDGKAPVILAVNKVDNVQEKV--DLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHL 173
8 -26.500[P] COG0370 Fe2+ transport system protein B  ali follow..  18  5..........................TYCILGNPNTGKTSLFNALTGSYE--YVGNWSGVTVEKKVGTLRSTGKLIDLPGYDLNPISRDET-----VVTRFLLEEKF--CMLNIVDSSQ---ERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLRI----PILPVVARSGKGTEDILSTLSEKH 161
9 -24.500[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  17  167.......................NTRTVLICGYPNVGKSSFMNKVTRAD--VDVQPYAFTTKSLFVGHTDLRYQVIDTPG--ILDRPFEDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTAQQAALFHSIKSMNKPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAEQVLLKMSTLTDEGVMSVKNAACERL 349
10 -20.500[R] COG0486 Predicted GTPase  ali follow..  20  229..........................KVVIAGRPNAGKSSLLNALAGREA-AIVTDIAGTTRDVLREHIH-PLHIIDTAGLREATDEVERI------IVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTKNIPVTIVRNKADLSGENEGIVEQNGY----------TVITLSAKTQQGIALLREHLKQSM 387
11 -19.600[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  22  143..........................LVMVVGVPNVGKSALINSIHQRLKRATVGPLPGVTQDIAGFKIRPSIYVLDSPGVLVPSIPDIETG--------------KLALSGSVKDSVVGEERIAQYFLAILNIRG........................................................... 251
12 -19.400[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  17  3...........................IVTSGHVDHGKTALLKALTGSTAHLPEEKKRGMTIDLGYAYLNKVLGFIDVPGH-------------EKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFH-IVVITKADRTNSAQIESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLA 162
13 -19.100[J] KOG1191 Mitochondrial GTPase  ali follow..  24  355..........................QIAIVGRPNVGKSSLLNAWSKSER-AIVTEVAGTTRDVVEANVT-PITLLDTAGIRETNDIVEKI------VERSETAAKVADVIIMAVSAVEGWTEEDTELLRKIQSDKQPMILVMNKIDCAPPGSCDQLEDQRKKEEV---FHKSVFTSAVTGQGIEELEDAILEIL 533
14 -19.100[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  19  37..........................TLMVVGESGLGKSTLVNSLFLTDKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEFLRDESGLNRFYFISPFGHGLKPLDVEFMKKLHSK-VNIVPVIAKADCLTKKEILRLKCRIMQEIE............................. 202
15 -18.900[D] KOG3859 Septins (P-loop GTPases)  ali follow..  22  44..........................NILCVGETGLGKSTLMDTLFNTKHTQPGVQLQSNTYDLQESNVRLKLTIVSTVGFGYKPIVEFIDAQFEAYLQEELKIRRVLHTLYFIAPTGHSLKSLDLVTMKKLDSK-VNIIPIIAKADAISKSELTKFKIKITSELV............................. 206
16 -18.700[DZ] COG5019 Septin family protein  ali follow..  22  97..........................NVLVLGESGSGKSTLVNTLLNRDNPEPTVMINSSAVEIVENGISLQLNVIDTPGFGDFIDNTDCWQPVLTDIEGYLELEKHNPRIFFIQPTGHAISAMELRVMLALHEK-VNIIPIIAKADTLTDDELNFTKEMILRDIQ............................. 265
17 -18.700[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  18  9...........................IGLVGHVDHGKTTLTKALSGWTDTHSEETKRGISIRLGYADITRKVSFVDAPGH-------------ETLMATMLSGAALMDGAILVIAANEPPQPQTKEHLMALDVIGVKVIVVQNKIDIVSKERALESYREIKEFVKCAEDAPIIPVSAQQGANIDILIETIEERI 197
18 -18.600[R] COG5258 GTPase  ali follow..  20  109..........................TVVALGNVDAGKSTLVGVLTDGKGLARSYVLTGRTSAVSLRLLDKLVLLVDVGGH-----------------ERYLRTSSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMGRVAPVFYVSSVTGHGLDLLLRFLSLL. 327
19 -18.600[R] COG2262 GTPases  ali follow..  16  194.....................KADVPTVSLVGYTNAGKSTLFNRITEARVYAQLFATLDPTLRRIDVADVGETVLADTVGF-IRHLPHDLVAAFKATLQETRQAT----LLLHVIDAADVRVQENIEVLEEIDAHEIPTLLVMNKIDMLEDFEPRIDRDE-------ENKPIRVWLSAQTGAGIPQLFQALTERL 361
20 -18.600[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  15  56.........................NTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGT-----VKPVHLIDVPGH----------SRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDF........... 217
21 -18.600[R] COG2229 Predicted GTPase  ali follow..  17  5..........................KIIFTGPVGVGKTTAIAAISDEALVMTLDRKRNTTVAMDYGAIDTKVHLYGTPG----------QERFNFMWEILS---QGSMGLVLLLDNARTNPLKDLE--FFLHSFKAPVVVGITKMDIRSQPGIDVYHKYLAKH---NLNVPVFEIDARKEDDVKQLVSAMLFSI 172
22 -18.500[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  28...........LTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGKNELERNITIKLGYANAKIYQLDDHVSFVDCPGH-------------DILMATMLNGAAVMDAALLLIAGNESPQPQTSEHLAAIEIMKLKILILQNKIDLVKERQAKEQYEQILAFVQGTEGAPIIPISAQLKYNIEVVCEYIVKKI 243
23 -18.500[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  17  22..........................ELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGNMRKITRGNV--TIKVWDIGG------QPRFRSMWERYC-------RGVNAIVYMVDALDKLEASRNELHSLLDKAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHS 181
24 -18.200[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  19  339........................IADLGLIGLPNAGKSTILNKISNAKHWQFTTLSP-TIGTVSLGFGQDVFTVADIPGI-------QGASLDKGMGLEFLRHIERSNGWVFVLDLSNKNPLNDLEVGTLEKVKTKNILIVCNKVDIDAEKSESFAKYLQVEKFSKSQEWDCVPISALREKT............ 499
25 -17.900[R] COG1161 Predicted GTPases  ali follow..  17  182..........................DVYVVGVTNVGKSTLINAIIKSADVITTSRFPGTTLDKIEIPLDEDSALIDTPGI-----RGQIAHYLEPEDLKYVSPRKEIKPKTYQLDPEQTLFFGGLARFDFISGERQGMTAYFDNEINVHRTKLEGATEFYEKHKG............................. 322
26 -17.800[R] COG0536 Predicted GTPase  ali follow..  19  159........................MADVGLVGFPSAGKSSLISVMSAAK--PKIGDYPFTTLQPNLGVVNETFTMADVPGL-------PGASEGKGLGLDFLRHIERTSVLVHVVDTATMDPGRDDEDTGLGDLSQRPRLVVLNKADVPEAEE---LAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIV 340
27 -17.800[R] KOG0394 Ras-related GTPase  ali follow..  16  10..........................KVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGLTKEVQFEDRLFTLQIWDTAG----------QERFQSLGVAFYRGAD---CCVLVYDVNSMKSFENLN--NWREEENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDA 176
28 -17.700[R] KOG0410 Predicted GTP binding protein  ali follow..  21  306.....................AIPVPVVSLVGYTNAGKSTLLNQLTGANVLAE-ATLDPTTRRVQM---GKEFLLTDTVGF-IQKLPTTLVAAFRATLEEIAESS----LLVHVVDISHPLAEQQIEVMSELDVSSIPKLVVWNKVDRVDDPQKVKLEAE--------ETGDTICISALTGEGLDDFCNAVHEKL 472
29 -17.500[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  17  19..........................RILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGF--KLNVWDIGG------QRKIRPYW----KNYFENTDILIYVIDSADRKRFEETGQEELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNV 177
30 -17.300[R] KOG1424 Predicted GTP-binding protein MMR1  ali follow..  26  389...........................VGLVGYPNVGKSSTINTIMGNKKVS-VSATPGHTKHFQTLYVEPGLCLCDCPGLVMPSFVSTKAEMTCSGILPIDQMRDHVPPVSLVCQ............................................................................... 476
31 -17.200[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  16  19..........................RILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQVTYKNL--KFQVWDLGG------QTSIRPYW----RCYYSNTDAIIYVVDSADRDRIGISKDEYMLREEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTL 177
32 -17.100[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  16  18..........................RLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF--KLNIWDVGG------QKSLRSYWRNYF-------ESTDGLIWVVDSRQRMQDCQRELQSLLVEAGATLLIFANKQDLPGALSSNAIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDI 176
33 -17.000[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  16  20..........................RILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETLSYKNL--KLNVWDLGG------QTSIRPYW----RCYYADTAAVIFVVDSTDKDRMSTASKELMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVI 178
34 -17.000[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  22..........................KILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKI--KFKAFDLGG------HQIARRVWKDYY-------AKVDAVVYLVDAKERFAESKRELDALLSDATVPFLILGNKIDHLGLTNFTTGKGKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYI 192
35 -17.000[R] COG1163 Predicted GTPase  ali follow..  13  59..................DVARTGVASVGFVGFPSVGKSTLLSKLTGTE--SEAAEYEFTTLVTVPGVIGAKIQMLDLPGI-------DGAKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELIRLNKTPPDILIKKKEK............................................... 187
36 -17.000[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  14  56...........................IGTIGHVDHGKTTLTAAITKCLS-APEEKARGITISSAHVEYNRHYAHVDCPGH-------------ADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVVINKVDMVEPDMIELVEMEMRELLSEYDGDNTPIVSGSALCALEGREPEI.... 226
37 -17.000[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  16  19..........................RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNI--SFTVWDVGG------QDKIRPLW----RHYFQNTQGLIFVVDSNDRDRVVEARDERMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNI 177
38 -17.000[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  16  23..........................RILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETVTYKNI--KFNVWDVGG------QDKIRPLW----RHYFTGTKGLIFVVDSADSNRISEARQERIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNA 181
39 -17.000[R] KOG2484 GTPase  ali follow..  18  269..........................RVGVVGIPNVGKSSIINSLTRGR-SCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRESVLKRASKEYFCTMYDITNYDTFEEF------------FAKKAARMGKFLKKGVPDVVAAARSVLN............................. 406
40 -16.800[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  14  58..................DVAKTGDARIGFVGFPSVGKSTLLSNLAGVY--SEVAAYEFTTLTTVPGVIGAKIQLLDLPGI-------EGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELIRLNSKPPNIGFKKKDK............................................... 186
41 -16.700[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  18  11..........................RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDKLQLWDTAG----------QERFRSITKSYYRNS---VGVLLVYDISNHASFEHIEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEV 175
42 -16.700[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  13  55.................DPFSTEVKPRILLMGLRRSGKSSIQKVVFHKNETLFLESTNKICREDVSNSSFVNFQIWDFPGQ-------------IDFFDPTFDYERGTGALIFVIDSQDDYMEALARLHLTVTRADINFEVFIHKVDGLSDDHKIETQRDIHQRANLEKIHLSFYLTSIYDHSIFEAFSKVVQKL 237
43 -16.600[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  18  14..........................KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFKFDVWDTAG----------QEKFGGLRDGYYINAQ---CAIIMFDVTSRITYKNVP--NWHRDLNIPIVLCGNKVDVKERKVKAKTITFHRKK-----NLQYYDISAKSNYNFEKPFLWLARKL 170
44 -16.400[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  16  56..................EVTKYGHGRVALIGFPSVGKSTLLTMLTGTH--SEAASYEFTTLTCIPGVIDTKIQLLDLPGI-------EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELLRLNKTPPQIYFKKKKT............................................... 184
45 -16.400[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  18  19..........................SILILGLDNAGKTTFLETLKKEKALEKIQPTVGQNVATIPVDSKQILKFWDVGG------QESLRSMW----SEYYSLCHGIIFIVDSSDRERLDECSTTSVVMDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDVLPISALTGEGVKDAIEWMIVRL 186
46 -16.300[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  17  181.........................PVVTIMGHVDHGKTTLLDKF--RKTQVAAVETGGITQHIGAFLVGEKITFLDTPGH---AAFSAMRARGAQVTD----------IVVLVVAADDGVMKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELLAYDVDYGGDVQAVPVSALTGDNLMALAEAT.... 338
47 -16.200[DTZ] KOG1547 Septin CDC10 and related P-loop GTPases  ali follow..  20  282..........................NIMVVGQSGLGKSTLINTLFKSKRIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFG----HINNENCWQPIMEKYLQEEVNINRKKRIPDTRHSLRPLDIEFMKRLSKV-VNIVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMI 477
48 -16.200[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  19  10..........................KILIIGESGVGKSSLLLRFTDDTFDPELAATIGKVKTISVDGNKAKLAIWDTAG----------QERFRTLTPSYYRGAQ---GVILVYDVTRRDTFVKLELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSM----LFIEASAKTCDGVQCAFEELVEKI 169
49 -16.000[J] COG0050 GTPases - translation elongation factors  ali follow..  13  15...........................VGTIGHVDHGKTTLTAAITTVLA-APEEKARGITINTSHVEYARHYAHVDCPGH-------------ADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVMNKCDMVDDEELLELVEEVRELLSAYPGDDLPVVRGSALKALEGEAEWEAK.. 188
50 -16.000[T] KOG3886 GTP-binding protein  ali follow..  15  37.....................TAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRR--GATILDRIHSLQ-VLNLWDCGGQ-------------DTFMENYFTSQRNVEVLIYVFDVESRELEKDMHYYQSCNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCTSIWDETLYKAWSSIVYQL 241
51 -15.800[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  15  11..........................KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGLSKTMYLEDRTVRLQLWDTAG----------QERFRSLIPSYIRDSS---VAVVVYDVANRLSFLNTS--KWIEEVDVIIVLVGNKTDLVEKRQVSIEEG---DSKGREYGVMFIETSAKAGFNIKPLFRKIAAAL 170
52 -15.700[R] KOG0395 Ras-related GTPase  ali follow..  15  21..........................RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEHRKVYNIRGDMYQLDILDTSG----------NHPFPAMRRLSILTGDVFILVFSLDNRES-LEVKSCLKNKTKEAAELPMVICGNKND-HGELCRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMA 190
53 -15.600[R] KOG1673 Ras GTPases  ali follow..  14  103..........................KISLLGDCQTGKTTFVVKYVGDQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGG---------DEKRSKDHIPIACKDAV---AILFMFDLTSRST---NSVFGWYSQATAIPILIGTKFDDFVRLPPNLQWTIVTQARAYAKVMNAFFSSATHNINVNKIFKFILARL 266
54 -15.600[T] KOG4252 GTP-binding protein  ali follow..  18  11..........................KMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGLERQIQVNDEDVRLMLWDTAG----------QEEFDAITKAYYRGAQ---ACVLVFSTTDRGSFEAVS--SWREKVDIPTVLVQNKIDLLDDSCIKNEEA---EALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKY 169
55 -15.600[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  14  59........GYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLP-SGIGH--TNCFLSVELRDDLVLVDSPGTD-------VTTELDSWIDKFCLDAD---VFVLVANSESTLMNTEKHFFKVNEWLSKPNIFILNNRWDASASEPEYMEDVRRQHMELEAQNRIFFVSAKE............... 287
56 -15.600[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  21  22..........................KLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGLTQTVCLDDTTVKFEIWDTAG----------QERYHSLAPMYYRGAQ---AAIVVYDITNEESFARAK--NWVKELNIVIALSGNKADLANKRAVDFQEA---QSYADDNSLLFMETSAKTSMNVNEIFMAIAKKL 181
57 -15.500[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  16  14..........................KIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQQNKTVNVEDCQADLHIWDTAG----------QEKYHALGPIYYRGSN---GVLLVFDITDRKS---EKVKNWVLEITAEILIVGNKIDLEEERQVTRQDA---EAYAESEGALYMETSAQDNVGISDAFESLTAKM 173
58 -15.400[R] KOG2423 Nucleolar GTPase  ali follow..  18  268..........................SVGFIGYPNVGKSSLVNTLRKKK-VCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDF-LTKIAIKQGRLLKGGDPDIVAVSKVVLN............................. 405
59 -15.300[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  14  11..........................KFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRAHLQLWDTAG----------QERFRSLTTAFFRDAM---GFLLLFDLTNEQSFLNVQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEA---IALAEKYGIPYFETSAANGTNISQAIEMLLDLI 181
60 -15.300[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  17  29...........TKLVNLSEFTPDKIRNFGIVAHVDHGKSTLADRLLEMCGAVPVERERGITQTAALRHRGYLLNLIDTPGH----------VDFSAEVSRSL---AVCDGILLLVAANQGVQAQTIANFWLAFEKNIQIIPVINKIDL-PGADIKSVETQLKNLFEFNPE-ECLHISAKSGLNVDKVLEAIIDRV 211
61 -15.300[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  24  93.........................PMILLVGQYSTGKTTFIRYLLESD--IRIGPEPGNARALSGFQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDR--IILLFDAKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLG............................. 275
62 -15.300[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  16  12..........................KLLIIGDSGVGKSSLLLRFADNTFSENYITTIGKIRTMDINGQRVKLQIWDTAG----------QERFRTITSTYYRGTH---GVVVVYDVTNGESFGNVK--RWLQEISVQKVLVGNKCEENERRVVLESDA---RNYAQSMNISFFETSAKEDKNVEPMFTCITSLV 170
63 -15.200[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  13  11..........................KIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGMIKTVEINGEKVKLQIWDTAG----------QERFRSITQSYYRSAN---ALILTYDITCEESFRCLP-IEQYASNKVITVLVGNKIDLAERREVSQQRA---EEFSEAQDMYYLETSAKESDNVEKLFLDLACRL 170
64 -15.100[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  15  10..........................KFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGGSRVVNVGGKTVKLQIWDTAG----------QERFRSVTRSYYRGA---AGALLVYDITSRETYNSLA-ARTLASPNIVVILCGNKKDLDPEREVTFLEA---SRFAQENELMFLETSALTGENVEEAFLKCARTI 169
65 -15.100[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  16  24..........................KILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGKVKTIYRNDKRIKLQIWDTAG----------QERYRTITTAYYRGAM---GFILMYDITNEESFNAVQ--DWSTQINAQVLLVGNKCDMEDERVVSSERG---RQLADHLGFEFFEASAKDNINVKQTFERLVDVI 183
66 -15.100[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  18  11..........................KLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGKIRTIELDGKRIKLQIWDTAG----------QERFRTITTAYYRGAM---GILLLYDVTDKKSFDNVR-VEQHASENVYKILIGNKCDCEDQRQVSFEQG---QALADELGVKFLEASAKTNVNVDEAFFTLAREI 170
67 -15.000[J] COG4108 Peptide chain release factor RF-3  ali follow..  11  1..........MLMSTTPYFGEVSKRRTFAIISHPDAGKTTITEKVLQVAGTVKGRGSNQHAKSMQFPYGDCLVNLLDTPGH-------------EDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPIVTFMNKLDR-EIRDPMELMDEVENELKIACSPITWPIGCGKEKGVYHIHR...... 189
68 -15.000[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  16  10..........................KLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGKIRTVEQDGKTIKLQIWDTAG----------QERFRTITSSYYRGAH---GIIVTYDVTDLESFNNVK-IDRYASENVNKLLVGNKCDLTSQKVVSTETA---KAFADELGIPFLETSAKNATNVEEAFMAMTAAI 169
69 -14.900[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  16  13..........................KYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGGTRIIEVSGQKIKLQIWDTAG----------QERFRAVTRSYYRGA---AGALMVYDITRRST---NHLSSWLTDANTVIILIGNKADLEAQRDVTYEEA---KQFAEENGLLFLEASAKTGENVEDAFLEAAKKI 172
70 -14.700[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  20  12..........................KTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGATRNIVLDNKKIKAQIWDTAG----------QERYRAITSAYYRGA---VGALIVYDITKQSSFDNVG--RWLKELNIVIMLVGNKTDLLHLRAVSTEEA---QAFAAENNLSFIETSAMDASNVEEAFQTVLTEI 171
71 -14.700[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  13  8..........................KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGGARMVTIDGKQIKLQIWDTAG----------QESFRSITRSYYRGA---AGALLVYDITRRDT---NHLTSWLEDANMVIMLIGNKSDLEARREVKREEG---EAFAREHGLVFMETSAKTAANVEEAFIDTAKEI 167
72 -14.600[M] COG0481 Membrane GTPase LepA  ali follow..  13  2......................KNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSLERERGITIKAQSVTLTYQLNFIDTPGH----------VDFSYEVSRSL---AACEGALLVVDAGQGVEAQTLANCYTAIEMNLEVVPILNKIDL-PAADPERVAEEIEDIVGIDAM-EAVRCSAKTGVGIEDVLEEIVHKI 180
73 -14.400[J] KOG0468 U5 snRNP-specific protein  ali follow..  10  128.....................PPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRYTDTLFTEQELNIFDTPGH--------------NFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQDAYFKLKHIVEEVNGLLSTYGAPDDNLLV........ 303
74 -14.100[R] COG0699 Predicted GTPases (dynamin-related)  ali follow..  18  262.......................TLPSIVVIGSQSSGKSSVLEAIVGQHILTDLNMAVPSSQGVDDNPIRPNLSLIDLPGY--EDQPADLDMKISKLCEKYIREPN----ILAVCAADVDLANSALRASRRVDPLGLRTIGVVTKMDLVPPSKAISILHNNNYPLHFSTHQQFADARIGNYLGIQSLRKCLINVL 522
75 -14.100[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  15  29..........................RFLTCGSVDDGKSTLIGRLLQLSSLHNDSKRHGTVAYRYFSTEKRKFIIADTPGH-------------EQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKLVVAINKMDLVDYSEIREDYLTFAGQLPGNLDIRFVPLSALEGDNVAS......... 215

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.