current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [C] COG0508 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MADIKVPVFSESVSEGTLLTWHKKPGEAVKRGELLAEIETDKVVLEVTAQQDGVLQSIAKNEGDTVLSEEVLGTMGEGDAAAPAPAAQDQASGPVASETTAGGTAQQPDSTGTQPAAQSGERREDLSPAVRKIVEEKGLDVSQVPATGPKNNITKADAMGASAPAPAAQPAPQAAKSAVVLPSGPRPEERVPMTRIRARIAERLKEVQNTAALLTTFNEVNMQPTMELRKKYQDQFVKKHGVKLGFMSLFVRAATEALKAFPMVNASVDGKDVIYHGYYDIGIAVASERGLVVPILRDTDNMSLADIEKQIAEFATRARAGKLTMEDMSGGTFSITNGGTFGSMMSTPIINAPQSAILGMHNIIERPIAQNGQVVIAPMMYLAVSYDHRLIDGKEAVQFLVMIKNLLEDPARMLLDLLast
1 -147.000[C] COG0508 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes  ali  100  1MADIKVPVFSESVSEGTLLTWHKKPGEAVKRGELLAEIETDKVVLEVTAQQDGVLQSIAKNEGDTVLSEEVLGTMGEGDAAAPAPAAQDQASGPVASETTAGGTAQQPDSTGTQPAAQSGERREDLSPAVRKIVEEKGLDVSQVPATGPKNNITKADAMGASAPAPAAQPAPQAAKSAVVLPSGPRPEERVPMTRIRARIAERLKEVQNTAALLTTFNEVNMQPTMELRKKYQDQFVKKHGVKLGFMSLFVRAATEALKAFPMVNASVDGKDVIYHGYYDIGIAVASERGLVVPILRDTDNMSLADIEKQIAEFATRARAGKLTMEDMSGGTFSITNGGTFGSMMSTPIINAPQSAILGMHNIIERPIAQNGQVVIAPMMYLAVSYDHRLIDGKEAVQFLVMIKNLLEDPARMLLDL 417
2 -116.000[C] KOG0559 Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit)  ali follow..  42  63VITVEGPAFAESISEGDI-RWLKQKGDHVNEDELVAEIETDKTSVEVPAPQAGTIVEFLVEDGAKVTAKQKLYKLQPGAGGGSS---SAPAKEEPKSAPAKEESKPAPAKEDSKPAVTAAAPPKPVSGDIPKSAPPVARPPSTPSSSTPVGAVPVTRVVVPKGVDPSHAITGA------------RDEVRVKANRMRMRIAQRLKDAQNTYAMLTTFNEIDMSSLIEMRKTYQKDFVAKHGVKLGMMSPFVRAAAYALQESPVVNAVLDENEIVYRHFVDISVAVATPKGLVVPVLRNVESMNYAQIELELANLGVKARDGKLAVEDMEGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGPEIRP-----------IMQIALTYDHRLIDGREAVTFLKKIKTAVEDPRIMFMNL 452
3 -113.000[C] KOG0557 Dihydrolipoamide acetyltransferase  ali follow..  28  86.QEIGMPSLSPTMTEGNIARWLKKEGDKVAPGEVLCEVETDKATVEMECMEEGFLAKIVKEEGKEIQVGEVIAITVEDEDDIQKFKDYTPSSDTGPAAPEAKPAPSLPKEEKVEKPASASEDRIFASPLARKLAEDNNVPLSSIKGTGPEGRIVKADVEDFLETTAKPSKQVDSKVPA-------LDYVDIPHTQIRKVTASRLAFSKQTIPHYYLTVDTCVDKMMGLRSQLNSFQEASGGKRISVNDLVIKAAALALRKVPQCNSSWTDEYIRQFKNVNINVAVQTENGLYVPVVKDADKKGLSTIGEEVRFLAQKAKENSLKPEDYEGGTFTVSNLGPFGIKQFCAVINPPQAAILAIGSAEKRVVPGTGQYNVASYMSVTLSCDHRVIDGAIGAEWLKAFKGYIETPESMLL.. 508
4 -40.000[V] COG4845 Chloramphenicol O-acetyltransferase  ali follow..  3.........................................................................................................................................................................................NSYQIIDFETKRKEYCQIY--RSAVQPQYCVSFELDVMNFKRYVKEN----------NLSFTMAFIFAVTKCANEIEEFRYRFLDGEVVLYESVDITFTYLDKETELFKVVNVPMQDTIEKFVQLAIVTAENQKEHFTGPVE--NDVYQFSALPWITFTHISHTDFGNREKAQPIFDWGKYHGRDG-----KLVMPFAVQVHHAFVDGIHIGKLADKLQRYLDE........ 208
5 -13.900[I] COG0511 Biotin carboxyl carrier protein  ali follow..  17  106..EVASPMVGTFYRAPA----FVEVGDRIRQGQTVCIIEAMKLMNEIEADVSGQVIEILVQNGEPVEYNQPLMRIKPD................................................................................................................................................................................................................................................................................................................................................... 182
6 -6.840[R] COG4908 Uncharacterized protein containing a NRPS condensation (elongation) domain  ali follow..  30.........................................HTVLTFDNHLN--IDVLKKAVMQSTKKLRLLLCHFKETNKGAFWQESVFSAEDLVFLIKTTEPEAEVNRALVRKLSTENGPQIRLTVVRTESADKLVIILNHMLADGAGFKEYLYLLSELYSKLLENPNYQANLSLGSRNLKQ---FDQFSRKEIKTIFTEKTNRKTVYNPPFPLKGDPKNPKIIWTKEVFDGIVHYAKENDATVNDVFFAAMVRIVQQTTHQNELSIDCPVDLRKYLPGKASQGI---ITCQINANDDLTSFESTLQAVKNSLNPQKNSKASEKMYSIPKTSFTNIGIIDEEKLI---GSTLTDCFICGSLKYAPFFQVAATTFRGELTLSTNLHGTTRDHDWQKHFLDQLAREFTL........ 421
7 -6.450[E] COG0509 Glycine cleavage system H protein (lipoate-binding)  ali follow..  13  24TYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAV....................................................................................................................................................................................................................................................................................................................................................................... 81
8 -6.400[YU] KOG2834 Nuclear pore complex, rNpl4 component (sc Npl4)  ali follow..  10  6IIRVQSPDGVKRITRETAATFLKKVAKEFGFQNNGFSVYINNKTGEITASSNKSLNLLKIKHGDLLFLFPSSLAGPSSEMETSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQQFGYLYG-IPLGIRAEVAAIYE-PPQIGTQNSLELLEDPKAEVVDEIAAKLGLFTDLVSEDTRKGTVRYSRNKDTYFLSSEE-AGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQ..................................................... 386
9 -6.140[E] KOG3373 Glycine cleavage system H protein (lipoate-binding)  ali follow..  16  62ISSYAQEALGDVV--------LPEPGTELKQDDECGALESVKAASEVYSPVSGKVIEK....................................................................................................................................................................................................................................................................................................................................................................... 114
10 -5.890[V] COG1566 Multidrug resistance efflux pump  ali follow..  12  69......................................MTDNAFVRMSPQVSGYVVNVPVKDYQEVKQGTLLAKIDDRIYHQKQAQAEATLDTHKAALDNSRQQENAANANIRSSEAAVDSAEASLKQAQLASDRQDNL---------KSGVGTSSLQEEAHAALEKARA--------------------------------SLSQAKAALEVSRQDLQTIIVNRSSLQAAVANAEAAVELARIDLANTEIRAPV---------------DGRLGEVGVRTGQYVTAGTQLVVPVIANFKETQLAGM--------QVGQPVTISVDALHRRKLTVERFSPATGSEFAVI--KPDNATGNFVKIAQR-IVIDADQPLAAELSPGMSVVVHL........................... 371

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.