current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [P] COG0735 Fe2+/Zn2+ uptake regulation proteins, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MVTPQLTKNQSLVMGALAHSDGPMSAYTILDKLRDNGFRAPLQVYRALDKLLEYGLVHRLESLNAFVACSCPHEHEHDHGVTAFTICEGCGQVTEFHDEVIEDRLSTLVRAQEFKTEKTTIEIRGHCKSCALast
1 -69.600[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali  100  1MVTPQLTKNQSLVMGALAHSDGPMSAYTILDKLRDNGFRAPLQVYRALDKLLEYGLVHRLESLNAFVACSCPHEHEHDHGVTAFTICEGCGQVTEFHDEVIEDRLSTLVRAQEFKTEKTTIEIRGHCKSCA 131
2 -12.800[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  19  14LKAIGLKKNEIRIYRLLVEKRRGMRIREIQRELGISE----RSVRTHVLNLYRRGLLKRELVQSG.................................................................. 74
3 -12.300[K] COG1695 Predicted transcriptional regulators  ali follow..  13  1.....MDRYAIKALVLL--SKKPRTLYQMSKEISTGVQVSHGTLMPMIRKLLQERYID......................................................................... 51
4 -11.300[K] COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon  ali follow..  13  1...MRWETRREKIVSLLTESREPLTIEEIAYMVGEDDKS---KIIEDLEHIAKT-----LRREGKTLLMEPAR-------------CNKCG----------------------YVFKSLRVKPPSRCPKC. 84
5 -10.900[T] KOG4603 TBP-1 interacting protein  ali follow..  10  5.RAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEM........ 126
6 -10.800[K] COG3682 Predicted transcriptional regulator  ali follow..  11  1...MHITAAEAHVMEALWRR-SPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDQHRPLKPDEVAKLKKLIDEM.................... 118
7 -10.400[K] COG4742 Predicted transcriptional regulator  ali follow..  13  6IDVVFRSQKRRDLLLLL--GEEPRTMEDIKVLLDVSPT----AILPQIKRLTDSNLVIQ........................................................................ 58
8 -10.300[K] COG4190 Predicted transcriptional regulator  ali follow..  18  67.....LTPRVLELIEAI-RQEEPASINETARVVDRDVK----NVHEELSRLAHLGIIFF........................................................................ 115
9 -10.000[K] COG3355 Predicted transcriptional regulator  ali follow..  30  25.....LSKSDVEVLHILLQ-NGKMTTDDLSQKLNVT----KASISKALNNLLDKGLIQR........................................................................ 73
10 -9.760[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  15  10LRSLNRSELRRKVLFYLLSIPYRSYLSEISRAVKSDPSNVKGCLYTGEESLIGLGLVIVEQSKNGFKYFKINPEIVE...................................................... 93
11 -9.690[K] COG1510 Predicted transcriptional regulators  ali follow..  10  24MHTFGMPSTVGRVLGIIYMNRKPMTLSELSEATGMS----KTRMSQVVREMIDANIAEKV....................................................................... 79
12 -9.500[K] COG2378 Predicted transcriptional regulator  ali follow..  20  17MYNMRKASRLFEIIQILRLARRPVTAQTIADMLEVTAR----SVYRDIAALQTMRVPIEGERGVGYI................................................................ 79
13 -9.410[DR] COG5124 Protein predicted to be involved in meiotic recombination  ali follow..  11  4.VKMKSDQKKSILLEIIRGSKSFFKLQEL-ESLGSKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRCKELMEECERMSQDICRKREYIENEKMSKHYTEERNELEN......... 123
14 -9.410[DR] KOG3433 Protein involved in meiotic recombination/predicted coiled-coil protein  ali follow..  11  4.VKMKSDQKKSILLEIIRGSKSFFKLQEL-ESLGSKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRCKELMEECERMSQDICRKREYIENEKMSKHYTEERNELEN......... 123
15 -9.350[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  13  28.....SGGIAVLVLDALTR-RQWVREEDLAKELKLNTKQ----LRTILRYFEEQQFIMRVHRKEKSSATTNGRGEDKVKVHMYSYCCLDYSQIYDVIRYKLHRMKKEFKDVLEDKDNVQEY----GCPNCK 144
16 -9.270[K] COG1414 Transcriptional regulator  ali follow..  16  14...APALDKGLDILELLASVDGGLTQAEIAKHLDRS----PNEFYRMLDRLVKRGYVTKLDGDRYSLTLKLFGLAQLHAPVR---------RLASFATPFMRELADRSKQANQLAVFDRGSVVV....... 121
17 -9.220[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  1MELSPVFARRLYLALLV-ESLERPNVPKLIEKTGWPRR----TIQDVIKAMPGIGIELN........................................................................ 54
18 -9.170[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  21  76AGLPGLSPIEILILHSIRHRDREKKLADICLALDIED---THIATYAIRKLEKAGLLTT........................................................................ 131
19 -9.100[K] COG1497 Predicted transcriptional regulator  ali follow..  20  9......ELTRFQILSEIAMRQPYVRQKDIADKLG-----TVQAVSENIKSLIAEGLVES........................................................................ 57

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.