current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG0779 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MGLSTLEQKLTEMITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVTLVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHFLast
1 -87.300[S] COG0779 Uncharacterized protein conserved in bacteria  ali  100  1MGLSTLEQKLTEMITAPVEALGFELVGIEFIRGRTSTLRIYIDSEDGINVDDCADVSHQVSAVLDVEDPITVAYNLEVSSPGLDRPLFTAEHYARFVGEEVTLVLRMAVQNRRKWQGVIKAVDGEMITVTVEGKDEVFALSNIQKANLVPHF 152
2 -6.820[K] COG5624 Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA)  ali follow..  16  343LSKRKLHDLLQQIIEPEVEELLLEIAD-------------FVES---VTNFACRLAKHRKSDTLDVRDVLERNWNIRL--PGIVKSARKTGPTPSYQQKQNAIGTAKSLNKD........................................ 450
3 -6.820[K] KOG1142 Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA)  ali follow..  16  343LSKRKLHDLLQQIIEPEVEELLLEIAD-------------FVES---VTNFACRLAKHRKSDTLDVRDVLERNWNIRL--PGIVKSARKTGPTPSYQQKQNAIGTAKSLNKD........................................ 450
4 -6.810[J] KOG3181 40S ribosomal protein S3  ali follow..  13  20........ELNEFLTRELAEDGYSGVEVRVTPTRTEII-ILATRTQNV--RRIRELTAVVQKRFGFPEGSVELYAEKVATRGLCYKLLGGLAVRRACYGVLRFIMESGAKGCEVVSGKLRGQRAKSMKFV...................... 153
5 -5.160[S] COG4466 Uncharacterized protein conserved in bacteria  ali follow..  9.........................................................................................KTNLDSRLGKALTLKANGGRKKTIERCGILAETYPSVFIVELDQDENNFERVSYSYTDILTD. 70
6 -5.130[S] COG3198 Uncharacterized protein conserved in bacteria  ali follow..  33....................................MFFVAQQHATDLVTDDYYKDGKHIDIQLHRDEEAVRHIGVQVLISPDMNAAKVFVGGEFDGKQPLNLLLMHPTRKADDQTVALKPVGSAQNG........................ 125
7 -5.110[C] COG2869 Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC  ali follow..  17  136.....................................................SVMYGLVSVQPDGNTINGITYYQHGETPGLGGEIENPNWASLFKGKKLQPAIRIVKGQAPQDEHSIDGLSGATLT........................ 215
8 -5.050[H] COG1441 O-succinylbenzoate synthase  ali follow..  10  115..........DDLILKLADMPGEKVAKVKVLLEAIPDLHLRLDANRAWTPLKGQQFAKYVNPDYRLEEPCKTRDDSRAFARETGIAIAWDESLREPDFAFVAEEGVRAVVIKPTLTGSLEKVRE--QVQAAHALGLTAVISSSIESSL.... 269
9 -4.930[W] KOG1574 Predicted cell growth/differentiation regulator, contains RA domain  ali follow..  13  3.....................................LKINIDGLEGVTDTTCSQI---IYALAHATS--RGRFVMVEKYRNVERRLAPTDRLRKWREHAANVTF............................................... 75
10 -4.860[S] COG4050 Uncharacterized protein conserved in archaea  ali follow..  18  1.....................................MKIAIFPPNSLILADL--VERRGHEPLVIQKEIKK----KVTDPEIDSPPFNITEEDPIRGKYAAIEVPSGVRGRMSIFGPLIEEADAAIIME...................... 88

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.