current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [U] COG0823 Periplasmic component of the Tol biopolymer transport system, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450
# Score Template Links and tools%idFirst MFKRLVFVLMLIGTGFSNIANAALELVITDGIDSARPIAIVPFKWEGATKLPEDVSAVIASDLQRSGKFSPVPTSKMPQTPYSEEQVNFGKWTSMGVDSLLTGTITQNAEGSYVISYQLVDIVRGQLTQGQSKALSQDGQLVLSKDHVLFNKVATVPASRMREYAHRIADLVYEELTGERGAFLTRIAYVVVNDKDPYPYQLRIADYDGYNERLVLRSKQPLMSPAWSPDGQTLAYVSFQNGQAEIYMMNIYSGKREKLTSFPRHNGAPRFSPDGKTLALVLSKTGNLQVYTMDLATRRLTEVTSGRSNNTEPFWHPDGKSLIFTSDRGGKPQIYQVNLSGGETKRLTWQGSQNLGGQITPDGKFLVMVNRSDSGFNLAKQDLETGAMQILTKTLLDESPSIAPNGGMVIYSSIYNKANVLSMVSIDGRFKARLPATNGRVRAPAWSPFLLast
1 -103.000[U] COG0823 Periplasmic component of the Tol biopolymer transport system  ali  100  1MFKRLVFVLMLIGTGFSNIANAALELVITDGIDSARPIAIVPFKWEGATKLPEDVSAVIASDLQRSGKFSPVPTSKMPQTPYSEEQVNFGKWTSMGVDSLLTGTITQNAEGSYVISYQLVDIVRGQLTQGQSKALSQDGQLVLSKDHVLFNKVATVPASRMREYAHRIADLVYEELTGERGAFLTRIAYVVVNDKDPYPYQLRIADYDGYNERLVLRSKQPLMSPAWSPDGQTLAYVSFQNGQAEIYMMNIYSGKREKLTSFPRHNGAPRFSPDGKTLALVLSKTGNLQVYTMDLATRRLTEVTSGRSNNTEPFWHPDGKSLIFTSDRGGKPQIYQVNLSGGETKRLTWQGSQNLGGQITPDGKFLVMVNRSDSGFNLAKQDLETGAMQILTKTLLDESPSIAPNGGMVIYSSIYNKANVLSMVSIDGRFKARLPATNGRVRAPAWSPFL 450
2 -41.700[S] COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system  ali follow..  12  20..ESTIYRYCAKYYYIGFHNHKDLIGKEFCGKHYILKIIHYHMKAYYMYPDGDLISFTSDDDV----WLLSLKDMKPLRITSGLGVSTRPKISPSGRKVAFSVIWKSGKQGGDIYVVED-RVTYFGSRNSRVAGWISEDEIIVITDFHQWTEAYKVNVNNGK--TEKLPFGMLSNIV--IKDDIIVIARGYQDLPNWKGYELWISSDGGKTFEKFVSLDGNVSWPMIVRER--VYFLSDHEGVGNLYSVDLKGKDLRRHTNFTDYYCMNEAVVNGNYIALVS----RGKVFLMRPWDGPSVQLGKKQGVKYQIQVLPNGDVIGVNDED----KLVILGKDGSE-KVINKDFSRIERVKVSPDGKKVLLSNNKL---ELWVYEIDNDNARLIDKSEYDLEFDWHPNAEWFAYAFPEGYTQSIKLAHIDGK-VVRITTPYGYDFSPSFDP.. 515
3 -28.000[E] COG1506 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases  ali follow..  16  25....................................................................................................................................................................................SPEGDKVAYLATKKENTYRSGIWLAEEDSY--RPLTGGPY-DRCPAWSPDGEIIAFSRTVNSNHYIAIVSPKGGEPQVLHESVSPATSIKWSSQGSMIGYLSRFDRYWGLTVISYPGGEVLLEKGGVNYNIDFDFAPDDNTIVYAVSTDMIHKLVLWDLASGREKTLI-EGLTIAAVAFDPRGRYIAVKANDRSHYKIFVYDLNSEEFVCLTCDPSCLRGMYWDDNGHLYYGVHNAGRMVVMKSRPLGEAEAVLDPSSATVDDFSISR.. 351
4 -22.900[J] KOG2314 Translation initiation factor 3, subunit b (eIF-3b)  ali follow..  11  233..........................................................................................QWSPIGTYLVTLHK-ADTFTRLMRYQHSMVKLVDFSPGEKYLVTYHSQEPSNPRDASKVEIKVFDVADEFSIGGPGGVAGASWPVFRWAGGKDDKYFAKLSKN-------TISVYETETFSLIDKKSMKVDNVV-CWSPTDSILSLFVPEQGGGNVALVQIPSKVERQKNLFSVSDCKMYWQSSGEYLAVKVDRYSGFELFRIKERDIPIEVLENKNDKIIAFAWEPKGHRFAVIHGDQPRPDVSFYSMKTAQSKLATLKAKQANALFWSPTGKYIILAGLKGFNGQLEFFNVDELETMATAEHFMATDIEWDPTGRYVATSVTTVHEMENGFTIWSFNGNMVYRILKDHFFQLAWRP.. 623
5 -22.200[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  13  1.......................................................................................................................MNFSEVFKLSSLLCKFSPDGKYLASCVQ---YRLVVRDVNTLQILQLYTCLDQIQHI--EWSADSLFILCAMYKRGLVQVWSL----EQPEWHCKIDEGSAGLVASCWSPDGRHILNTTEFHLRITVW--SLCTKSVSYIKYPKACLQGITFTRDGRYMALAERRDCKDYVSIFVCSDWQLLRHFDTDTQDLTGEWAPNGCVLA-VWDTCLEYKILLYSLDGRLLSTYSAYEWSLKSVAWSPSSQFLAVGSYDG---KVRILNHVTWKMITEFGHPAAINDAFSPDSYFLA-TRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDP.. 383
6 -21.400[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  8........................................................................................................................SRKTRHTEMVCGVGWIGTEA-ILSAADDHVFLLTNTATNESQQILNMPETFFPTSLH-TKGGQNDVFAVSTSDG------KINILSRNGKVENMVDAHNGAALCARWNSDGTGLLSSGEDG---FVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYC---NADHCYIKSLKMQVAPIKWKAHDGIILCCDWNPTSDLIVTGGEDL---KFKVWDGFGQILFNSSVHDYPITSISWNTDGTLFA----VGSHNILRLCDKSGWSHSLEKNAGSVMALSWSPDGTQLAVGTAAG---LVFHAHIIDKRLT.................. 302
7 -20.900[S] KOG1407 WD40 repeat protein  ali follow..  10  2............................................................................................................EETTIPFKSLHSREYQGHKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGSKAKDLELKGHTDSVDQLCWDPKHSDLVATASGDKS-----VRLWDARSGKCTQQVELSGENINITYKPDGTHVAVGNRDD---ELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFF-LTTGLGTVEVLSYP-SLKPLDTLTAHTAGCYCIAIDPKGRYFA-VGSADSLVSLWDIS-DMLCLRTFTKLEWPVRTISFNYSGEYIA-SASEDLFIDIANVQ-TGRTVHQIPCRAAMNSVEWNPKYNLLAYAGDDK.................................. 296
8 -20.300[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  10  160...........................................................................................................EIDGDVEIPPNKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGG-DWNSDGTLLAMGSYDG------FARIWTENGNLASTLGQHKGPIFALKWNKKGNYVLSAGVDK---TTIIWDAHTGEKQQFPFHSAPALDVDWQNNMT--FASCSTDMCIHVCRLG-CDHPVKTFQGHTNEVNAIKWDPSGMLLA-SCSDDMTLKIWSMK-QDACVHDLQAHSKEIYTIKWSPTGPIMLASASFDSTVRLWDVEQGVCTHTLMKHQEPVYSVAFSPDGKYLASGSFDK---YVHIWNTQSGSLVHSYQGTGGIFEVCWNA.. 503
9 -20.200[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  14  19.............................................................DLQAMFAQTISNAPRTEEPTHVPQSVSVSSKSESGVSSS---AVSDDEDDFMPDLPPGFQMQQSEAGPSSSRAEGPEDSDDSDFDETEAISIIKLIPAACEAKISHGTQAISA----RVEPPGVRFASGGLDY------YVKLFDFQKMDMELLPAESHVINSLAFSPNGETLVVAS---GEAIIRLLDRAGKQLNITKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDRKVIKTKGANGKRVSPQVCTFSPDGKWIA-AGCDDGSVQAWKYGSQYVNVNYLVRKAHNGTSIAFSPDSKRLLSRGFDD---TLKMWSLDNPKEPLLVKTGLENA-GFSPRAEVVFTGTNKDTPGTLQFFDPTFDLVYKIDYPGISCHRIQWHP.. 428
10 -19.800[J] KOG2315 Predicted translation initiation factor related to eIF-3a  ali follow..  11  24..........................................................................................NMAPSTPLLTVRGSEGLYMVNGPPHFTESTVFPRESGKNCKVCIFSKDGTLFAWGNGEKVNIISVTNKGLLHSFDLLKAVCL------EFSPKNTVLAYSTSKDGTAGIPNLQLYDVTGTCLKSFIQKKMQNWCPSWSEDETLCARNVNNESFVRLYQYPNFAGPHAALANKSFFKADKVWNKKATAVLVIASTDGEQTLHYIATNGESAVVQLPKNGPIYDVVWNSSSTEFCAVY---GFMPAKATIFNLKCDPVFDFGTGPRNAAYYSPHGHILVLAGFGNLRGQMEVWDVKNYKLISKPVASDSTYFAWCPDGEHILTATCAP-NNGYKIWHYTGSILHKYDPSNAELWQVSWQP.. 439
11 -19.600[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  52.....................................................................RVFAKPFLASLDGHRDGVNCLAKHPEKLATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQ------QVDIWDEQTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRN--IVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFV-SASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIM---CGSDEMNIRLWKANASEKLGVLTSKLKEKFQHYPHIKRIA--RHRHLPKSIYSQI-QEQRIMKEARRRKEVNRIKHSK.. 426
12 -19.200[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  11  117...................................................................VDCILTKFIRTAMNKVKCPVYSVCWSPEGKRLI-----TGCQTGEFTLAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSAHKDEAIRG----AFAPTDVKFATASDDG------TARVWDFRYTEERVLRGHGAEVRCIDWHPTKGLIA-TGSRDTQQPVKIWDPKSGSLATLQEHKSSVMAVEFNKNGNWLL-TGGRDHLVKMYDIR-MMKEMRTYRAHKKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILA-TGSNDNNTKFWARNRPGDTVEDIFGLSNTNEPRMAPPKPSIETQETYRPDTFIPGMGLDEHLYEQLNRDHNMMTTDSTLL.. 494
13 -19.200[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  70.........................................................LIAVNEKGEAQLISMMSCTVIHRHKFQTGVQCICFSPNGAFFAVAVQ-APGEITGEYNPFVLRRRFLGGFDDVTWLDWSSDSRLLAIGCRDSSTKIVAIN-YTKNFRTYNLSGHTDAIVACFFEANSLHLNTISRNG-KKEKKAVSDNESEDADEPRKEQRDVQLTAANYNTRTKVLV-VAFSSGAFYLYELP-DVNMIHSLSISDYPISAALFNCTGDWVALASREIGQLLVWEWQ-SEQYIMKQQGHSSEMTCIAYSSDGQFIA-TGGEDSKVKLWNTQ-SSFCFVTFSEHTSGVTGIQFSRNKKFLV-SSSLDGTVRAFDVNRYRNFRTFTSPNPAQSCVAVDYSGELVVAGGQDVFDIFLWSVK-TGKLLEIISGHEGPVVSIAFSP.. 531
14 -19.100[S] KOG0283 WD40 repeat-containing protein  ali follow..  13  393...................................................................................................................ALHMCQEIQAHEGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLC---DSSGNEITVVEKKKKDYVHVPETVFSFSDKPVCSLKGHLDAILDLSWSKSQLLLS----SSMDKTVRLWDIETKTCLKLFAHNDYVTCIQFSPVDENYFLSGSLDAKIRIW--SIQDRHVVEWSDLHEMVTAACYTPDGQGAL-IGSHKGICRAYDTEDCDVQSNKKSQAKRKITSFQFSPVNPSEVLVTSADSRIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDS---QVYLWKNDFHRTRSTLTTQSHEH........ 727
15 -19.100[T] KOG4378 Nuclear protein COP1  ali follow..  11  3...................................................................................................................................SNLVEPSWRLLAASGGDTV-KLFDVSADSGDPCVLSYTPSPGCAVNSKWNHTNLVVASTGEDK------KISLWRKNGQSLGTVPSAEECLSAISFSKKGSRYICSGGTGQIVKIW--DLQRKLIKKLKGHTSTITGVMYNCKDEHLA-SVSVGGDLIVHNLA-SGARATELKDPNGQVVQ-DYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSG-SRRSSSCIAYEAPFSSLAFGDNGYILV-AGTSNGRVVFYDIRGKPQPVTVLHSNSEDVTSLSWQT.. 325
16 -19.000[S] KOG0282 mRNA splicing factor  ali follow..  178.......................................................RKKFKENDASNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEI--TAKRQKKGKQEEEKPGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLP----KKQIHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCK----KLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSAAYDR---YLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDISGEIVQEYDRHLGAVNTIVFVDENRRFV-STSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDN---QILIFGAQNRFRLN-MVAGYACQVDFSPDMSYVI-SGDGNGKLNIWDWK-TTKLYSRFKAHDKVCIGAVWHP.. 560
17 -18.900[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  13  13.........................................................................................................................AQEAKRSKNDLMAYTNRDKALLESGVR--------RTSNLQAPIMQLEGHEGEIFTAEFHPEGELLL----SSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDK---TLAFWDIATGQQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIW--DARKKHAAHTLESPFQVTAVCFGDTGEQVI-SGGIDNEVKIWDIR-KQAVLHHLRGHSDTITGMSLSPEGDFIL-TNAMDNTLRVWDVRPYAPGERCVNFEKNLLRCAWSPGSDKIT-SGSADRHVYIWDVN-TRRILYKLPGHNGSVNAVDFSP.. 326
18 -18.900[R] KOG0288 WD40 repeat protein TipD  ali follow..  12  182........................................................................................................................EMLAKLKANGLETLARQQVDGIVRRNEDGTDHFVESTIPS--TCANRIHAHEGGCGSIVFEYNSGTLF----TGGQDRAVKMWDTN-SGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSN---NLFVWDVSSGRRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLW--DLHKGYCTNTVLFTSNCNAICLSIDGLTVF-SGHMDGNLRLWDIQ-TGKLLSEVAGHSSAVTSVSLSRNGNRILTSGRDN---VHNVFDTRTLEICGTLRASGNRRSCISPDDDYVA-AGSADGSVHVWSLS-KGNIVSILKEQTSPILCCSWSG.. 497
19 -18.600[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  10  4...............................................................................................................................................................VCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHGCGTLLILDPDEAGLRLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHAQEVYSVDWSQTRGELVVSGSWDQTVKLWDPT-VGKSLCTFRGHESIIYSTIWSPHIPGCFASASGDQTLRIWDVK-AAGVRIVIPAHQAEILSCDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELLHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHTEFTCGLDFSL.. 296
20 -18.500[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  11  19...............................................................................PRTQRGQPIVLGADPKGKNFLY------TNGNSVIINPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDT-VNKEHLLKNEFQPIAGPIKDISWSPDNQRIV--AVGEGRERFGHVFMSE-TGTSVGEISGQSKSINSADFRPARPFRIVTGSEDNTIAVFEGP-PFKFKMTKQDHSRFVQAVRYSPDGKFFA-SAGFDGKVFLYDGT-SSELVGEFGAHKGGVYALAWKPDSTQLL-TCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDNLI-TVSLSGVITYLNVADPSKPLRVVKHNKPITVLGLSDDRSTIYTGSHDG---VVTNWNSGSGTNDRITGTGHGNQINGIAA.. 376
21 -18.400[S] KOG0293 WD40 repeat-containing protein  ali follow..  10  199................................................VNSRSKVLEELQTLLPASVIIPEKRLECLVENSLH-IQRDSCVFHNTLDSDL--SLYSDHQCGKHQIPSQTAQILESHTDEVWFLQFSHNGKYLASSSKDQTAIIWEISADGHISLKHTLVGHHKPVIAILWSPDDRQVLTCGAEE------VIRRWDVDGDCVHMYEKGGISPISCGWYPDGQGIIAGMTDR---SICMWDLDGREKECKGQRTQKVSDIAMTDDGKWLV-SVCKDSVISLFDRE---ATVERLIEEEDMITSFSLSNDNKYIL-VNLLNQEIRLWNIEGDPKIVSRYKGHKRSRFSCFGGYKQAFIA-SGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIWGLDRNQQNQKKKLVQGSSSNGVIHRC.. 586
22 -18.400[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  15  447...................................................................................................................................SFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCA----TISNPTRHVYTGGKGC-------VKVWDISHPGNKSCLNRDNYIRSCKLLPDGCTLI-VGGEASTLSIWDLAAPTPRKAELTSSAPACYALAISPDSKVCF-SCCSDGNIAVWDLH-NQTLVRQFQGHTDGASCIDISNDGTKLW-TGGLDNTVRSW--DLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESS---NVEVLHVNKPDKYQLHHESCVLSLKFAYCGKWFVSTGKDN---LLNAWRTPYGASIFQSKESSSVLSCDISV.. 749
23 -18.300[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  11  3.......................................................................................................................................DQQQLILATGGYDHTIKVWQAHTGNCIKTMRFVETSQVNALD---TPDKTRLA-----ACGYQCIRLYLESNCTAPVINFDGVQKNVTRLGFQEDGNWMF-TAGEDHHVRIWDMIAAPPHCSRIFDCEAPVNAACLHPNQVEIA-MGSQNGSVFLWDVK-SERHERIVPEVDASIQDVAISPDGRYLA-AANNKGNCYIWSLTSQDQKMRKIPAHSRYILRCKFSPDSRLLL-TTSGDGTVCIWKTDDFSKWRELCIENYWVWDAAFSADSKWLF-TASSDGIARLWKLQ-TKSSIRDYTGHTKAITALSFKD.. 308
24 -18.300[R] KOG2055 WD40 repeat protein  ali follow..  11  209...........................................................................DANFQAPSHSGIRCMSIHPYFPLLLTCGF--DRTLRIYQLDGKVNPLVTSLHLRSQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRMYGQENFQPSMER-DPTGKYIALEGRSG------HINLLHALTGQFATSFKIEGVLSDVLFTSDGSEMLVLSYGA---EVWHFNVEQRSVVRRWQVQDGVTHFCLDPSNKYLA-IGSKSGIVNIYDLQAAPKPVTTLDNITFSINSMSFSQDSQVLAIAS-RGKKDTLRLVHVPSFSVPTSATPLGRVTCLAFGKGGELCV----GNEAGRVGLWKLAHYDLKFVPDKIINWEIRLGKFGYVLLGIQILILHVDVVIL.......................... 556
25 -18.200[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  11  69.....................................................................VVMNQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVLDAPGLRDDFSLNLLDWGSANVLAIALGDTV--YLWDASSGSTSELV-TIDEDKGPVTSINWTQDGLDLAVGLDNS------EVQLWDCVSNRQVRTLRGGHESRVGSLAWDNHILT-TGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSESGNKQA-SGGNDNVVHIWDRSLTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQSERELLSSHFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVA---SAAGDENLRLWNVFGEPPKTTKKAASKKYPELFSH.. 439
26 -18.100[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  319.........................................................................................................................TFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPTSVEDSDGSVRLLSHSGPVYG-TTFSPDSCSEDASARLWSVD-TKTALVAYKGHTGPVWDVAFGPFGHYFA-TASHDQTAQLWSCD-HIYPLRVFAGHLSDVDCVTFHPNSAYVL-TGSSDKTCRLWDVH-RGHSVRVFNGHTQPVTAVAIAPDGHTMA-SADSEGLIHLWDIG-TGRRIKTMRGHRGNIYSLSFSRESTVLV-SGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFNEVNW----------STSPDQMVALYTKQTPIFNVSFTR.. 633
27 -18.000[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  11  94........................................................................VTRCSASIPGHGEPVISAQFSPDGRGLASGSGDQ---------TMRIWDIELELPLHTLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQWITSLA-HKDPTCRLLASCGKDG------NIFIWDTQGTVVRCLSGHTASVTCLRWGGEGL--IYSGSQDRTVKMWRAD-DGVMCRNMTGHAHWINTLALNTDYALRT---SCFEPSKRCIKPDTVEECQKVAQTRYEAA--LEIAGGERLV-SGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSPDTRYIA-SASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLV-SGSADSTLKVFELK-TKSLYYDLPGHGDEVFTVDWSP.. 454
28 -17.700[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  12  407................................................CPRAKRVKLNIDAELPSPRDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDK---------TVKIWEIATGRCIR-RCVAWCPNPKLSIIAVATGNRLLLVNPKVGDKVLVKKTDDLLAEAPSQDVI--------ESERIKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYLATVMPEGANRSALIHQLSKRRQIPFSKSKGLIQFVLFHPVKPCFF--VATQHNIRIYDLV-KQELVKKLLTNSKWISGMSIHPKGDNLL-VSTYDKKMLWFDLDLSTKPYQTMRLHRNAVRSVAFHLRYPLFA-SGSDDQAVIVSHGMVYND-LKKLQTHEKRDE-NWHPVQPWVF-STGADSTIRLYT........................... 784
29 -17.600[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  5.........................................................................................................................LLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWC----DADWDTKHVLTGSADN------SCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQ-QCFVSFFDLNNEPYMKIPCNDSKITSAVWGPLGECII-AGHESGELNQYSAK-SGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN---TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEGKFEARFFHLAFEEEFGRVKGHFGNSVAFHPDGKSYS-SGGEDGYVRIHYFDPQ....................... 317
30 -17.500[S] KOG0295 WD40 repeat-containing protein  ali follow..  11  55.....................................................................................................................TVLRLQRKVNDLESKLQESQREINHGAPTRDKRQAADWIPRPPETQKLTGHRLPITR----IFHPLWTIMASCSEDA------TIKVWDYEGQLERTLKGHTDAVNDIAIDAAGKQLVSCS-SDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVL-SASRDHTIKQWDIS-TGYCVYTFRGHNDWVRMIRISNDGTLFA-SASLDQTVTVWSFA-TKSAKLVLRDHEHAVECVEWAPDTAHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLI-SVADDKTLRVWELS-AQRCMKAIEAHEHFVSTVAFHQ.. 384
31 -17.500[T] KOG0279 G protein beta subunit-like protein  ali follow..  12  1.............................................................................................................................................................MAEGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDG---ELRLWDLATGETRRFVGHTKDVLSVAFSTDNRQIV-SASRDRTIKLWTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSSWDKTVKVWNLQ-NCKLRNTLAGHSGYLNTVAVSPDGSLCA-SGGKDGVILLWDLA-EGKKLYSLEAGSIIHSLCFSPNRYWLCAATENSVDLKAEAEKTDGSTGIGNKTKVIYCTSLNWSA.. 304
32 -17.400[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  10  1.......................................................................................................................MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWV-KAHELKEHNGHITGIDWAPKSDRIVTCGADR------NAYVWSQKDGVTLVILRINRAATFVKWSPLENKFAVGS---GARLISVCYFEAENKHIKKPIRSTVLSLDWHPNNVLLA-AGSCDFKCRVFSAYIKEMSEFGGSGTGGWVHGVSFSASGSRLAWVSH-DSTVSVADAS-KSVQVSTLKTEFLPLLSVSFVSENSVVA--AGHDCCPMLFIYDDRGCLTFVSKLDIPKQSIQRNMSAMERLETLHQNSITQVSIYEVDKQDCRKFCTTGIDGAMTIWD... 356
33 -17.300[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  14  4......................................................................................................................................................................................................................VGHDTGSILAIDCHPSGKKFI-QKARTSNGLVVVWNAEPPKLLFQVESQSQSNSCRWSPDGKRFA-FGSDDSSVSVWEYVGLINSCCVLRGHSMEVLTVEWSPNGKYLA-SGSIDYRIIIYNARKLPDRITVLNDIQLPVKGLSWDPIGKYLA-SLEGDKKLRFWATD-SWQCVKSVTEPFESNI-DWSPDGKYLM-AAVRSGKPLIKLIQRQTKSDQFLAGHHKGTTCVRAMPRL 274
34 -17.100[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  10  121........................................................................................................................ECLMMLNQLPFCLGFANNESLLAVCTETGALELFDSRFYDRQNEENQPSARRIHGWLANFSKDDSLLATSSGDQ------TSKVFDLSTQQCITDGYHSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGRKAHENSGRDCSITSATWLPQSTSQVISSC-SANSALKLWDLRTVHTVRTSKRDFGVTNVCTSPDGERIYAASRDS---IIYEYSSRHLNSGFCLRISSFYVKLACSPDGATLACVQDKTSGVVVFDTTRNCSSSAMLTGGHTKDAVDWSSEGQLA--SISDDGSVRVWNSSLHGSAANLREKNFSEIFYWGFSE.. 489
35 -16.900[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  12  7..............................................................................................................DSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDL----HFTHANNTAIHSSTKVDD----TIRYLSLDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDK---TLRLWDLRSPNCQGLMHLSGRPIA-AYDPEGLIFA-AGVNSESIKLYDLRSFDKTFKLNQEKECDWTGLKFSRDGKTILISTNGS---VIRLVDAFHGTPLQTPNNKGIPIEASFSPDSQFIFSGSTDG---RVHIWNADTGNKVSVLNGDHPGP-QFNPKYMMLASACT---NMAFWLPTSEEG..................... 316
36 -16.800[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  4................................................SSEDNNLMEKVLPPVEQ--VLTWTLIQICMQESDVELETKVKKYLRGE-GANLETLKDKKLKTQLASREKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTDIANSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKG------HLALLDMMNMSLIKEIQVRETVRDVAFLHNDQFFA----AAQKKYAYIYGRDGTELHCLKERGPVAR--RFLKNHFLLA-SVNMSGQLHYQDVT-HGGMVASIRTGKGRTDVMEVNPYNSVVG-LGHSGGTVTMWKPT-SQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKER---KIKIWDLRKFEEVQTIHSFHAKTLSFSQKGLLAA---GTGSFVQILSSHNYTRYMNHSMVKGYQIEKVMFRP.. 390
37 -16.800[R] KOG1273 WD40 repeat protein  ali follow..  10  15...........................................................................EVIEEYLEHGVIKCVAFNHRG-SLLAAGCADG--------GCVIWDFETRGIAK-TSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQTPLQARLNPGLSSPSLCLACPLSSAPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVY-IGNSKGEILIVDYKSVRVLALVSASGAAPVKNIVFSRNGQYLL-TNSHDRTIRIYENLLPAKNKMKTVGSKCLTLAPCFSGDGEWVVGGSACKGEHKIYIWDRAGHLVKILEGPKEALIDLAWHPVHPIIV-SVSLAGLVYIWAKDYTENWSAFAPDKELEENEEYVEREDEFD-LIPETEKVKVLDVN-EDEEVDIDTVEKDAFSDSDMSV.. 412
38 -16.800[R] KOG0286 G-protein beta subunit  ali follow..  11  42.................................................................................................................RVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMT----AYAPSGNFVA-CGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFLDDNNIVT----SSGDTTCALWDIETGQKTVFVGHTGDCMSLAVSPDFNLFI-SGACDASAKLWDVR-EGTCRQTFTGHESDINAICFFPNGEAIC-TGSDDASCRLFDLR-ADQELICFSHESIICTSVAFSLSGRLLF-AGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVA-TGSWDSFLKIW............................ 339
39 -16.800[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  11  224..........................................................................................VRAREALEVPSAARAGRMVEMQKKLSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKADEENVVAMASGGHDGAVKLWGFNNEESIADITGHMPHRVSKVAFHPSGRFLATACYDS---SWRLWDLEQKTVLHQEGHAKPVHCLSYHSDGSVLV-TGGLDAFGRVWDLR-TGRCIMFLEGHLGAVFGVDFSPNGFHIA-TGSQDNTCKIWDLR-RRQPVYTIPAHTNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNKVISVDIAPNSQYIA-TTSFDRTFKLWSPDS........................ 553
40 -16.600[R] COG2319 FOG: WD40 repeat  ali follow..  13  198.................................................................................................................................................................................................................................SWSPKGDLAI-----GLAENIYLWSKELGPTRVLEESIYDVSSVAYSYNGDILAVGRVDG---TLQFWQDNERVPRISIHHPGDIGVLAWKPVLENRLLVGKGNGNIFVYDIIWAVLVATITNAHDEQVCGLTWNHDGSQFA-SGGNDNRVCLFKGSDLRQPLYVWQQNAAVKALSFCPWQRSLLATGAGSHDKHIRFYNCFNGKKIDELYCGAQITSIHWSP.. 418
41 -16.500[A] KOG0285 Pleiotropic regulator 1  ali follow..  4...................................................................LNREVETQSLKKLSLKSVRRAREIFSPVHGQFPQPDPESKRIRLCHKIQVAFGGVEKTAPLKALALPGPKGSKELRKSATEKALVVGPTLPPRDLNNTGN-PGKSTAILPAPGSFSERNLSTAALMERMPSRWPRPEWHAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADR---TIKIWDVATGVKLTLTGHIGQVRGLAVSNRHTYMF-SAGDDKQVKCWDLE-QNKVIRSYHGHLHGVYCLALHPTLDVVL-TGGRDSVCRVW--DIRTKMQIFVLPHDSDVFSVLARPTDPQVI-TGSHDSTIKFWDLRYGKSMATITNHKKTVRAMALHPKENDFV--SASADNIKKFSLPKGEFCHNMLSLQRDIINAVAVNE.. 387
42 -16.500[R] COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat  ali follow..  11  1..............................................SWLMDDKVRDQFVLQDDVKTSVFSMFNEEDSLVESRENWSTNYVRFSPKGTYLFSYHQ-----QGVTAWGGPNFDRLRRFYHPDRNSSVSPNEKYLVTFSTEPIIVEEDNEFSPFTKKNEGHQLCIWDIASG------LLMATFPVIKSPYLKWPLVRWSYNDKYCARMVGDSLIVHDASFAPEGVKLQPFRNGDEPSTATIAEVPRGRVKTVNLVQVSNVTLHWQNQAEFLCFNVERHSNLQICRLTERDIPVEKVELKDSVFE--GWEPHGNRFVTISVHEPANTIRFYAPETKEKTDVEIPKTFANTVSWSPAGRFVVVGADYPGEKNINDNNDVSASLKDVAHPTYSAA-TWDPSGRYVTAWSSSKVEHGYKIFNIAGNLVKEDIIA--GFKNFAWRP.. 472
43 -16.400[R] KOG0645 WD40 repeat protein  ali follow..  15  1.......................................................................................................................................................................................................................SGHTGRLWSVAAHPMLPLFA-TSSQDKSVRIYNSNTYNLVHVIDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINKIDDDWECTAALEGHENEVKCIAWSCNGNYLA-TCSRDKSVWIWEATEEFDCLAVLQEHTQDVKVVTWHPTEDLLV-SGSYDNSICFWRDDGDDWALTCQLQGHTNTALAFSPNGNTLA-SADNDGNVFLWIKISSNEDVSLPHIHKGAVYTISWMN.. 255
44 -16.200[R] KOG2096 WD40 repeat protein  ali follow..  6................................................VVGIASVILGALIAVLF--FGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKDKNQNKRHHPLDLNTLKGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRW----------------------FTLQAHFHDLTVFFVCFLKFRFLRINLPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQKKRSVLTISGATATYGTADGSVVIA-SCSEGTDIVLWHGK-TGRNLGHVDTNQLKNHMAAVSPNGRFLA-AAAFTADVKVWEIVYEVSRVMQLKGHKSAVTWLCFSPNSEQII-TASKDGSIRVWNINVRYHLDED-GNPLHYDRLSLCPEGKILAASH--GSTLQWLCAETGNVLDTAEKAHEGDITCISWAP.. 421
45 -16.100[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  13  2.........................................................................................................................SLCGHTSPVDSVAFNSEEVLVLAGASSGVIKLWDLEES---KMVRAFTGHRSNCSAVEFHPFGEFLA----SGSSDTNLRVWDTR-KKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDN---VVKVWDLTAGKLHEFKCHEGPIRSLDFHPLEFLLA-TGSADRTVKFWDLE-TFELIGTTRPEATGVRAIAFHPDGQTLFCGLDDG----LKVYSWEPVICRDGVDMGWSTLGDFCINEGKFIGCSYYRN---SVGIWVSDISELEPYGAVSEDKN-SVLNDQSERMGSGPRG.................................. 283
46 -15.800[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  11  20...................................................................................................................................AVDWILEEAVRSKITKDQDDDDDDGSSSSSYIV-----------LSGGGG---------EGRSGIPNVILICRVDLHTNSLSRRVIGTDLPYRMAIHPRQGGLI--CALPNSCRLFDWEEESEKVVKELKDVGQQLSLSFNQDGTVLA-TGAEDGTLRVFEWP-SMKTLLNESKTHASVKSLTFSESGKFLVSLGARGGSIITWDTTSWRRRSSKLIKRNNSISAFNVSADGKLLAVGTLEG---DVLIIDSTKMQTNQIVKKAHLTALTFSPDSRCLV-SVSFDSRARLTVIKQKGEKRRVYLWVAALLFVLVYVV.. 371
47 -15.700[S] KOG4328 WD40 protein  ali follow..  11  212..........................................................................................................................VVPGRIFVVQFLPCENVKMVAAGDKLGNVGFWNLDCGNEEDGIYLFTPHSAPVSSIVFQQNSLSRVISSSYDGL-----IRLMDVEKSVFDLVYSTDEAIFSLSQRPNDEQSLYFGQDYGV--FNVWDLRAGKVFHWELHERRINSIDFNPQNPHVMATSSTDGTACLWDLGAKKPKTLSTVNHSRAVHSAYFSPSGLSLATTSLDN---YIGVLSGANFENTCMIYHNNTSFKAVWGWDDSYIY-VGNLSKKIDVINPK-LKRTVMELHNPLQRAIPCCHPYNVGTLAGSTAGGQVYVWTTK......................... 516
48 -15.600[BK] KOG1063 RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily  ali follow..  10  375................................................SPNSLSILAHGYGGANVSSSKESENWQMQKVPSGHFAAVTDVTWARTGEYLLSVSQDQTKNDEGNEAEDEHWHELARPQVHGVAMVQGKGNHRFVSGAEEKVVRVFEAPLSTLNHTCAGGEGSFPEDLQADVQVLGANMSALGLSQK-------PIYLHSSSEPLERNGGGEGLDTFETVPEAAPAE-LKEPPIEDQLAFHTL-WPESHKLYGHGNELFSLCSDHKGNLVA-SSCKAQSASMAEIWLTWKAVGRLQSHSLTVTHLEFSYDDTLLL-SVSRDRHFSVFSIQRTDNGMAKVEAHKRIIWACSWNPFGHQFA-TSSRDKTVKIWSVENDARIKQILVLPPFGSS-AWTGLDSGCVAVGMESGLIELSNVKALALRLEPFMCHVSAVNRLAWRP.. 811
49 -15.500[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  10  115...................................................................................................................GRRCWTSSTEAQHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQVYDCVWYPHMNSLQPETCLWLATRQHE------PIHMWDADGSLRCSYVDEVMAAISLAFSHDGEQIY-----GYKRCIKIFDTSPGRFCDDYPVKFAISCIAQTTAHPHTLTCGNWHGYIQHFDLRCSHKQLFTLGGHKGGITQLRYGEFGNGLFSGARKCDKILQWDMRNYKQPLVELQRHVDTNQRIQFDSDSNWLA-SGDTRGFVNVWDLKKYGDPSVLPLHSDCCNGVALNPAMPILATSSGQLNGTETTELPAPADVNQNQKEVLYENAVVMWW... 482
50 -15.500[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  43..............................................................................RLFTGGSDTIIRTWSVPHHKDAFSARGGVRSPGKNS-PVQYQGSLEQHTDWVNDMILCGHGKILISASNDTTVKVWNIERDNKHGFIDCIRTHKDYVSCLAYAPIVEKAV----SASFDHNIFVYDINANFKTVNNLIGCKDSIYSLATTPNLSLVLGAGTEK---CIRLFDPRTNEIMKLRGHTDNVRALVVNDDGTRAL-SAGSDATIRLWDIG-QQRCIATCIAHEEGVWTLQVDSSFTTVY-SAGKDKMVVKTPLY-DFTKSQLLFKEEAPVKKLLLSEKDNPVSLWVGTWKS-DIKRWSIRPSAQLSIGGDEDGPKHAMLSDKRHVL-TRDSDGNVALYDVLIKDYGKRIFEEVVDENSRQVYIP.. 448
51 -15.400[G] COG2706 3-carboxymuconate cyclase  ali follow..  12  2........................................................................................................................................................................................KQTVYTASPESQ----QIHVWSLNHEGTLTLVQVVDVPGQVVVSPDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSP-STDHHGRFVFVGSYNAGNVSVTRLQDGLDVVEGLDGCHSANITPVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSVEGFQPTEAQPNIDNSGKYLIAAGQKSHHIAVYEITGTQGLLTEKGRYA-VGQGPMW.... 325
52 -15.400[R] KOG2394 WD40 protein DMR-N9  ali follow..  13  19.........................................................................................................................AANPQSPGIKTYFKTPEGKYKLHYEKTHSSGLLYAHGKTVTQVTIAQLKERAAPSTPTGTSSGYSASSGFRSAGGNGGGKSVSTSSRISGSFAASNSNTSMTNTNFDGKGTYLVFNVSDA----IFICDLNSQEKDPVKSIHFSNSNPMDAKDGHDLLIGLNSG---DVYTVSLRQQLQDSVNNRQDRCTSISWVPGGDGAFVVAHADGNLYNKDGASKSNPVARWHICQGSINSIAFSNDGAHLATVGRDG---YLRIFDFLTQKLVCGGKSYYGACCSWSMDGKYIL-TGGEDDLVQVWSME-DRKVVAWGEGHNSWVSGVAFDS.. 395
53 -15.300[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  10  441........................................................................................................DIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGP--LCVVMSSNGE------QCYSGGTDGL-RGPLLGHTDAVWGLAYSAAHQRLLSCSADG---TLRLWNTTEVAFNDIKELGIPASVDLVSSDPSHMV-ASFSKGYTSIFNMETQESNVDTTANSSCQINRVISHPTLSISI-TAHEDRHIKFYDNN-TGKLIHSMVAHLEAVTSLAVDPNGLYLM-SGSHDCSIRLWNLE-SKTCIQEFTAHRKKFE-AFHPSKCYIA-SAGADALAKVFV........................... 780
54 -15.300[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  1.........................................................................................................................................................................................................MSATELPTKEAHILKGHEGAVLAARFNGDGNYALTCGKDR---TIRLWNPHRGIIKTYKSHGREVRDVHVTSDNAKFC-SCGGDRQVYYWDVS-TGRVIRKFRGHDGEVNAVKFNDSSSVVV-SAGFDRSLRVWDCR-SHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDG---TVRTFDMRIGREMSDNLGQPVNCISISNDGNCVL-AGCLDSTLRLLDRT-TGELLQVYKGHISKSTDCCLTN.. 238
55 -15.200[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  17.......................................VEEVIKDNDKLMDQGVTEDEAEQEQNDTMNNMVMDMSVQGFFEHKDSVFSVSINPVHSNLCASGGGDDLGYIWDITTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFETVDEIVW----SWHPKGLFLAAGCNDG------SIWMWSLSGKVVQVMYGHTAPVNAGKFIPPGVKRLATVDDSGTLIVWMSSDDHRFDPGNEETAAGWTSFDCNAEGNVLF-LGGSSGKVKVVNIN-SSHILASLEAQTESVEAIALCTALPICA-CASVDGTVALY--DSASLKFRKSLPHEQAVIDCKFLPNTPYLL-TACADCVIRKWDVRSGQLLGEYTGHQEPILCMAITPDGKRVV-TGSDDTELLVFDCE......................... 398
56 -15.100[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  1................................................................................................................MPLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPV------------RSAKFVARKQAGADDMYIRVYNYNMDKVKVFEAHSDYIRCVAVHPTLPYVL-SSSDDMLIKLWDWEKGWACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLG-SPDPNFTLDAHQKGVNCVDYFTGGDKYLITGSDDHTAKVWDYQ-TKSCVQTLEGHTHNVSAVCFHPELPIII-TGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEG---TIMVKLGREIPVASMDNTGKIIWAKHNEI.. 322
57 -15.100[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  288................................................DKTGRILACHGTDSVLE--LFCILSKKEIQKKMDKKMKKARKKAKLHSSKGEEEDPEVNVEMSLQDEIQRVTNIKTSAKIKSFDLIHSPHGELKAVFL--LQNNLVELYSLNPSLPTPQPVRTSRITIGGHRSDVRT-LSFSSDNI-SAAADSIKIWNRSTLQCIR-TMTCEYALCSFFVPGDRQVVIGTKTG---KLQLYDLASGNLETIDAHDGALWSMSLSPDQRGFV-TGGADKSVKFWDFELVSVKQTRTLQLDEDVLCVSYSPNQKLLA-VSLLDCTVKIFYVD-TLKFFLSLYGHKLPVICMDISHDGALIA-TGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFF-TAGKDHKIKQWDAD-KFEHIQTLEGHHQEIWCLAVSP.. 685
58 -15.000[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  13  6...................................................................................................................................................................................................................CEIAWHNKEPVYSLDFQHGTAGIHRLASAGVDTNVRIWKVEKGPLSNLARHTKAVNVVRFSPTGEILA-SGGDDAVILLWKVNDNKTVVKTLRGHLEDVYDICWATDGNLMA-SASVDNTAIIWDVS-KGQKISIFNEHKSYVQGVTWDPLGQYVA---TLSCDRVLRVYSIQKKRVAFNVSKMLSGRLSFTPDGSLLLTPAGCVETTYVFSRKNLKRPIAHLPCPGKATLAVRCCPVY 297
59 -14.400[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  47..........................................................................................QWLPEVTHWLVLGTHTSDEQNHLVV----ARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRAR----------YMPQNPHIIATKTPSSDVLVFDY--PSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELSWNPNEPWVICSVSEDNIMQIWQMA-----ENIYNDEESDVTTSELEG.. 422
60 -14.400[R] KOG1539 WD repeat protein  ali follow..  10  240................................................STDGRPLLASGGSFGVISIWNLNKKRLQSVIRDAHDSSIISLNFLANEPVLMSASA--DNSLKMWIFD-RLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQE---QQSRELSQRHISRRAKKLRLKEEELKLKPVVS-------DCAEIRERDWCNVVTCHMDTAEAYVWRLQNFVLGEHILKP---CPENPTPIKGVFVSRNHLLLAILACAISACGNFAV-VGTAGGWIERFNLQYFDMSEKRRYAHDGEVIGVACDSTNTLMISAGYHG---DLKVWDFKKRELKSQWDVGCSLVKIVYHRVNGLLATVADDF---VIRLYDVVTLKMVREFRGHTDTDLCFSEDGKWVISSSMDG---SLRIWDVILAKQIDGVHVDVPITALSLSP.. 629
61 -14.300[R] KOG1334 WD40 repeat protein  ali follow..  11  266...................................................................................................................RFRLQYLLGSHAGSVSTIHFNQRGTRLASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGDSTLAMCGHDG------QVRVAELINASTKRVAKHRGPAHELALEPDSPYKFLTSGEDAV--VFTIDLRQDRPTRENDKKVGLYTISMNPANIYQFAVGGHDQFVRIYVLKKFTPHHLVYCDFPTNITCVVYSHDGTELL-ASYNDEDIYLFNSSLSDGAQYVKRYKGHRNND-FYGPRSEFVVSGSDCG---HVFFWEKSSSQIIQFMEGDRGDI-EPHPYLPVLATSGLDQ---HVRIWTPTAKTATELTGLKDVIKKNKQER.. 613
62 -14.300[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  14  15...................................................................................................................REILYRLMISQLMYDMELSMLVKADQCAPSERLL--HVMIAGMQTLSDKDKTNSDDVLPGIDLEFEPEASALA----------------PEPHSYETAYVTSHKQACRAGAFSCDGSLVATGSVDA---SIKILDVERMLARTLYDHTDEVSYLEFHPKEHILA-SASRDGTVKLFIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVA-IGTEHNVLRVYDVATTQCFVSAIPSQQHKATCVKYSPTGKLYATGSYDG---DIKIWDGISGRCINTIAEAHGGAAEFTRNGKYLL-SSGMDSLVYLWELCT........................ 330
63 -14.300[U] KOG1332 Vesicle coat complex COPII, subunit SEC13  ali follow..  1..................................................................................................................MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGEGPVWQVAWAHPMYGNILASCSYDR------KVIIWREENGTSHEHAGHDSSVNSVCWAPHGLILA-CGSSDGAISLLTYTGEGQ-KKINNAHTIGCNAVSWAPAVVKRFASGGCDNLIKLWKEEEDGQEEQKLEAHSDWVRDVAWAPSTSTIA-SCSQDGRVFIWTCDDASSNPKLLHKFNDVVWHVSWSITANILA-VSGGDNKVTLWKESVDGQWVCISDQGSVSASVTEGQQNEQ.......................................... 322
64 -14.300[R] KOG0646 WD40 repeat protein  ali follow..  12  2.........................................................................................................................................EITVIASSSIDEGIGSWDLKTGTEQLQFKPCASPAHGTAVGEKFLASSQLSARNTSG------SIFYWSWTKPQAEVKSYPVEPIKALAANNEGTYLVGGGISG---DIYLWEVATGKLKKWHGHYRSVTCLVFSGDDSLLV-SGSQDGSIRVWSLQGNTLYEHNFNEHTMSVTDIVIDYGGCNAVIISS-SEDRTCKVWSLSRGKLLKNIIFPSVINALALDPGGCVF-YAGARDSKIYIGAINATSEYGTQVLGSVSEKG-AYCADGNLLI-SGSEDGVVCVWDPK-SLRHVRTLIHAKGSRKGPVNN... 314
65 -14.200[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  19..........................................................................GAVDDDVAEADIISTVEFNHSG-ELLATGDKGG--------RVVIFQQEQENKIQSHSQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRSPRRIFANAHTYHINSISINSDYETYL----SADDLRINLWHLEITDRANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMREDPSNRSFFSEIISSISDVKFSHSGRYMM--TRDYLSVKIWDLNMENRPVETYQVHEYLRSK-CWNGSDSVVMTGSYNN---FFRMFDRNTKRDITLEASRENNKPAWHPKENIIAVATTNN----LYIFQDKVN..................... 447
66 -14.100[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  10  1................................................................................................MAAIINQRVEQGESSMGGAKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDND--QFWPSIHHFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVADDFNSMTESRKWTCHAGPISGLGFALSSELIFSCSRDK---SIVWHCSENSNK--MGSYLLENSCTAMVIDLPFVF-VGDHGGHVTVLRIVDNQPNVSKLSAHTNAITSLTWDGNKKVLY-SGSSDHLIIMWDIGGGRGEAYELNGHNGKVTTLCAAPAAKRLFSADEHG---KLMCWDMNCKRVETPEWKTSDCNQPFFWNLQAMWQRKVVG.................................. 313
67 -14.100[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  24..........................................................................................RWSANGQKLFSTCT-----------VVKVIDLADNTASYTTCTAVDKNRNRLLVAYNNQIIREYSIPLDPSTTKPELARTWKTIHTAPILNEEGHLLATGSADH------IVKVWNLTEQQCTHTLKGPSVVSAILFGKHEKLVV--GYIEGQLNLYNIMRGAPKKNTWKSHNSHITALLQVPDSRVVV---ALSRDQTMSIHETETQETLRVLPLYESIEGGAIGHNGN--LFTVGEEGVVKEFVIE-TAKLVRKKRIASSNLDHLAYDVVSNRFLAISAEQ---NLIILDFENLKIARQIVGFHDECCLLGKDESHMAVASNTGHTESVLSVVSPTWDTSLLASCSKDNSIIFWR... 389
68 -14.000[S] COG3490 Uncharacterized protein conserved in bacteria  ali follow..  11  37.......................................................................................................................................................................................RTDAVFASAFRARDGSYGIATVSERGEIIDRVALPARA--GMATSHATGRTVAFARRPGT-FFMAFDPVQRQEPVAPENRHFYGHGQFSPDGAILYASENDGNRGVIGLYDARN-GFARIGEYDAHGVGTTVSDDGRLIVIANGGIEEPSLVLLDAATGQLIQKHVMPEQLRQ-DLGDNGRIWFACQYEGPRNNLPPLVGHFSKGEDVAFVDLPEETAVNRREGLVGLTSPSGNA--AVTLDAKTGSVVSVSSYDGFRSDVAWDQHI 359
69 -13.800[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  1..........................................................MAQPYLPAEKFLSRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSV---------RLTLYDTVVCEPLNLCSIDFRHDGRLLAIGGDEGKVRIFDVETGSSKVALRVMQASQSTVKSVHFSPRGDTVF-SMADDGKIKQYRV-AYGVNAVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLW--DIRSKEKSLELDCEHPVESVLFLPGEQLIA----TAAGPIVKIWDTTGRQLTALQAHYKTVTSLRLATNSTCLL-SAGIDRRVNAF--RTTNYSLINSWSMPSPVLDIDVSRDDQTMA-IGMGNLLALYRRAEIKKEATASAAIEDKRSLIRTSAPPVKLV---EKDRDMQKVDVVAKNADKLKIPKIDGMLSNFKHAAVI 382
70 -13.800[KL] KOG4283 Transcription-coupled repair protein CSA, contains WD40 domain  ali follow..  10  33................................................................................................................................................................................................................SNRKDFVSPHRGSVNSLQVDLTEGRYLLSGAADGSAAVFDVQIFTVDKQHENGHKYAISSAIWYPIDTGLFITGSFDHYLKVWDTNTAQAVVDFKMPGKVYRTAMSSMAMSHTLIAAGTEDVQVRLCDIA-SGAFSHTLSGHRDGVMSVEWSTSSEWVLYTGGCDG--AIRFWDIRRAGCFRVLDQSQTQ--GFRPPILKRTAVGSKVCS................................ 254
71 -13.800[R] KOG0289 mRNA splicing factor  ali follow..  151.......................................................PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRG-KTVPEELVKPEELSKYRQVASHVGLHSASIPGILALDLCPDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQ----DLVFSASPDATIRIWSV----PNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQ---YWAFSDIQTGRVLTKVTDETSGTCAQFHPDGLIFG-TGTMDSQIKIWDLK-ERTNVANFPGHSGPITSIAFSENGYYLA-TAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALG---GTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFIA-STGMDRSLKFYSL.......................... 504
72 -13.800[Z] KOG0313 Microtubule binding protein YTM1 (contains WD40 repeats)  ali follow..  12  44...........................................................................................................................KNEFHKHVEFDFLIKGQFLRMPLDKHMEVENISSEEVVEIEYVEKCTAPQPEQCMFHDDWISSIKGAEE---GSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLLLLSASMDQTILLWEWNVERNKVKALHCCRGHAGS-AVDGSGTKFC-SGSWDKMLKIWSTVLTRTPIVTLSGHMEAVSSVLWSDAEEICSASWDHT----IRVWDVGSGSLKSTLTGNKVFNCISYSPLCKRLA-SGSTDRHIRLWDPRTKDGSLVSLSLTSHTGSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTD.. 396
73 -13.700[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  11  2....................................................................................................................................SFFNRSNTTSALGTSTAMANEKDLAND---VINSPAEDSISD----AFSPQQDFMFSASSWDGK----RIWDVQNGVPQGRAQHESSSPVLCTRWSNDGTKVASGGCDN---ALKLYDIASGQTQQIGMHSALRFVQCGPSNTECIVVVATAERHIAIINLANPTTIFKATTSPLKWQTR-ACYNEADGYA-IGSVEGRCSIRYIDDGMQKKSGFSFKCHRQTNPAFHPLYGTFV-TAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPDYPNVIRLHATTDEEVKE...... 361
74 -13.600[R] KOG2321 WD40 repeat protein  ali follow..  17..............................................SGEGVTQRLPNWI-SKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVYKP--------HIKVFDFAEMSLKFERHEILSDDWTKSVHLQTDRTVDFHSQGGIHYSTRIPKYGRDL------KYHYPNCDLYLAAAGD------EVYRLNLEKIESAQIDSPTGGVNVIDINPMHQLLAFGTDAG---SVEFWDPRDRSRTPYSDNSRSVTALKYRNDGLNVA-IGLSDGATLLYDLRSSSPYMSKDQGYSMPIKSLHWMDSALDGTARVLSADSKIIKIWEKDTGKPFSSIEPTVELNDVCPIEGTGLIL-TANEGSPMHAFYIPSLNSFLDNITEEMEENPAPTIYDDYKFV---TKKELLNLGLDHLVGTGVIRAYMHGFFIDNNLYEK.. 423
75 -13.600[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  11  236..............................................SKSNGGTNLCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGITGDSSGNILVNRISYAVQGAHEGGISPLCMLRDGTLVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVA---EGKGDVILIGTTRN------FVLQGTLSGDFTPITQGHTDELWGLAIHASKPQFLTCGHDK---HATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVA-VGTLTGRWFVFDTE-TKDLVTVHTDGNEQLSVMRYSPDGNFLA-IGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSF-DWSVNSQFLVSN---SGDYEILYWVPSACKQVVSVETTRDIE-CRAHEKKLLSTGDDFG-SSHVTNVDFLCEDSHLISTGGKDTSIMQWR... 715

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.