current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG1084 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MIIPTVPTTDELLDKGFRRARKAASLKRSSKIPGQKKAKVIESTRVQTACQVIRDRLKMIIQRIPDIESLPEFYQDYIDVTVGVDELKKSLGALNWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDNVLast
1 -107.000[R] COG1084 Predicted GTPase  ali  100  1MIIPTVPTTDELLDKGFRRARKAASLKRSSKIPGQKKAKVIESTRVQTACQVIRDRLKMIIQRIPDIESLPEFYQDYIDVTVGVDELKKSLGALNWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDNV 336
2 -78.400[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  31  8.RITVVPNGKEFVDIILSRTQRQTPTV-VHKGYKINRLRQFYMRKVKYTQTNFHAKLSAIIDEFPRLEQIHPFYGDLLHVLYNKDHYKLALGQVNTARNLISKISKDYVKLLKYGDSLRCKCLKVAALGRMCTVLKRITPSLAYLEQIRQHMARLPSIDPNTRTVLICGYPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSFMNKPLVIVCNKTDLMPMENISEEDRKLIEELLKMSTLTDEGVMSVKNAACERLLDQRVEAKMK. 359
3 -43.700[R] COG2262 GTPases  ali follow..  14  40..........EALQVITGSRKAPHPK------YFVGEGKAVEIAEAGASVVLFDHALSAQERNLERLCECRVIDRTGLRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETDRRLLRNRIVQIQSRLERVEKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVDVGETVLADTVGFIRHLPHDLVAAFKATLQETRQ-ATLLLHVIDAADVRVQENIEAVNTVLEEIDAHEIPTLLVMNKIDMLEDFERIDRDEENKPIRVWLSAQTGAGIPQLFQALTERLSGEVAQHTLRL 372
4 -42.500[R] COG1160 Predicted GTPases  ali follow..  18  1MATPVVA-KSTLFNRLTRTRDALFPGLTRDRKYGHAHIAGYDFIVIDTTEEGVEEKMAEQSLLAIDEADIVLF---LVDARAGLTAADIGIANYQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRIKIAIVGRPNVGKSTLTNRILGERVVVFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKLAVEKFSVIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNA----GRSLVIVVNKWDGLDQDVKDRVKSELFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTS. 395
5 -41.100[R] KOG0410 Predicted GTP binding protein  ali follow..  15  151..........AVVGSTYQKLASPNPR------TYIGSGKVAEIKSADVETVIFDDELSPG--QLRNLEKAFGGDVRVCDAATHEAALQVALAQMEYQLPRLTRMWTHL-ERQSGGQVKGMGEKQIEVDKRILRTQIGVLKKELESVRKHRKQYRSRRVAIPVPVVSLVGYTNAGKSTLLNQLTGANVLAENRLFATLDPTTRRVQMNGKEFLLTDTVGFIQKLPTTLVAAFRATLEEIAE-SSLLVHVVDISHPLAEQQIEAVEKVMSELDVSSIPKLVVWNKVDRVDDPQKVKLEAEETGDTICISALTGEGLDDFCNAVHEKLKDSMVWVEALL 483
6 -39.200[R] COG3596 Predicted GTPase  ali follow..  18  28.......................................................................................................................................................LQQINQLTHYEPVIGIMGKTGAGKSSLCNALFAGESPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGV--GESGVRDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIG--EAYRHKMLFVISQSDKAEPTSLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVA. 226
7 -37.700[R] COG1163 Predicted GTPase  ali follow..  18  1.............................................................................................MSTTVEKIKAIEDEMARTQKNKATSF----HLGQLKAKLAKLRRELLTSASSGSGGGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDGRG----KQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINS.................... 217
8 -37.500[R] COG1159 GTPase  ali follow..  21  11....................................................................................................................................................................IAIVGRPNVGKSTLLNKLLGQKISISRKAQTTRHRIVGIHTEGPYQAIYVDTPGLHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDD-----EMVLNKLRDGKAPVILAVNKVDNVQEKVDLLPHLQFLADIVPISAETGMNVDTIAGIVRKHLPEAIHHFPED. 183
9 -36.900[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  19  1.............................................................................................MSSTLAKIAEIEAEMARTQKNKATAH-------HLGLLKARLAKLRRELITPKGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKG----RQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDA.................................. 202
10 -36.600[R] KOG2486 Predicted GTPase  ali follow..  15  49.............................................................................................NLATVEPIPLSVSDSTDLDDAPVEIALDKLFIPPETDISGEDSASLTTRILKGSNIVLSKYARDAADGLPEFALVGRSNVGKSSLLNSLVRRKALTSKKPGKTQCINHFRI---NDKWYLVDLPGY-HELKQDWNKFTKDYFLNRSTL-VSVFLLVDASIPVKPIDLEYASWLGQ----NQVPMTLIFTKCDKRKKKKNGGKKPEATPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH..... 318
11 -35.300[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  17  1.....................................................................................................MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASG-EGFEVTKYGHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKG----RQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFKKKKTGGISFNTTAPLTHIDELHEYKIHNAEVLFRENATVDDFIDVIEGN..... 235
12 -33.600[R] COG0536 Predicted GTPase  ali follow..  20  121...........................................................................................................................GNGGLGNAALASKARKAPGFALIGEPGEAHDLILELKSMADVGLVGFPSAGKSSLISVMSAAKPKIGDYPFTTLQPNLGVVNVGHETFTMADVPGLIPGA-SEGKGLGLDFLRHIERTS-VLVHVVDTATMDPGRDQSALDEDTGLGDLSQRPRLVVLNKADVPEAEELAEFLKEDIEPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKE. 350
13 -33.000[E] COG4917 Ethanolamine utilization protein  ali follow..  15  1.................................................................................................................................................................MKRIAFVGSVGAGKTTLFNALQGNYTLARK-------------AVEFNDKGDIDTPGEYFN-----HPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDI------GVSKRQIAVISKTDMPDADRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTH. 156
14 -31.900[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  20  301...........................................................................................................................GQGGLGNMHFLTNLIRNPRFSKPGRNGLEQHFLFELKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTVSLGFDVFTVADIPGIIQGASLDK-GMGLEFLRHIER-SNGWVFVLDLSNKNPLNDLQLLIEEVGTEKVKTKNILIVCNKVDIDAEKSESFAKYLQVEDCVPISALREKT....................... 499
15 -31.000[R] COG0218 Predicted GTPase  ali follow..  15  22..............................................................................................................................................................QDELPEIALAGRSNVGKSSFINTMLNRKARTSGKPGKTQLLNFFNI---DDKMRFVDVPGYARVSKKEREKWGCMIEEYLTTRENLVVSLVDLRHDPSADDVQMYEFLKY----YEIPVIIVATKADKIPRGKWNKHESAIKKDFILFSSVSKAGMDEAWDAILEKL........... 195
16 -30.300[R] COG0486 Predicted GTPase  ali follow..  21  134.....LAQAEAIADLIDASSEQAAR------------------SALKSLQGEFSNKVNQLVDSVIYL-------RTYVEAAIDFPDEEIDFLADGKIEAHLNDIITQLDHVRSEAKQGSILREGM--------------------------------------KVVIAGRPNAGKSSLLNALAGRAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGL-REATDEVERIGIVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTKLP-SNIPVTIVRNKADLSGENEGIVEQNGY--TVITLSAKTQQGIALLREHLKQSMGYQTNMEGGFL 398
17 -30.200[P] COG0370 Fe2+ transport system protein B  ali follow..  26  5...................................................................................................................................................................TYCILGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVGTL--RSKTGKLIDLPGIYDLNPISRDETVVTRFL-LEEKFDCMLNIVDSSQ-----IERNLNLTVQLLEY-GAPVVMGLNMIDVAAGRGIHLNIQNLAKPILPVVARSGKGTEDILSTLSEKHVAPAI...... 166
18 -29.400[J] KOG1191 Mitochondrial GTPase  ali follow..  13  190....VVDSNGNVVDEVLAVPMLAPRSYTREDVVEL---------QCHGSEVCLRRVLRTCVEAGARLAEPGEFLRAFLNGRLDLSQAENVEKLISAKSSAAADAALEGIQGGFSSLVKSLRAQCIELLTEIEARLDNKITSMSQDVESALDTANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSRAIVTEVAGTTRDVVEANVTVRGVPITLLDTAGI-RETNDIVEKIGVERSETAAKVADVIIMAVSAVEGWTEEDTELLRKIQSDKVYLKQPMILVMNKIDCAPPGSCDQKKEEVFHKSVFTSAVTGQGIEELEDAILEILGLDRVPTGGHQ 544
19 -25.000[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  16  18...............................................................................................................................................................KEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIP--TVGFNMRKITRGNVTIKVWDIGG---------QPRFRSMWERYCRGVNAIVYMVDAADLDKEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDELSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR...... 186
20 -23.800[J] COG0012 Predicted GTPase, probable translation factor  ali follow..  21  2...................................................................................................................................................................EIGVVGKPNVGKSTFFSAATLVDVEIANYPFTTIDANVGVTYA--IPVKMIDVAGLVPGA-HEGRGLGNKFLDDLRM-ASALIHVVDVTGKTDAESQEDLLAFASEIRRINKPMIIAANKADA-QINRLIKEGEKRGYIVVPTSAAAELTLRKAAKA................ 263
21 -23.600[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  17  15...............................................................................................................................................................DQEVRILLLGLDNAGKTTLLKQLASEDISHI----PTQGFNIKSVQSQGFKLNVWDIGG---------QRKIRPYWKNYFENTDILIYVIDSADRKREETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPALHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK...... 182
22 -23.300[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  19  15...............................................................................................................................................................SREMRILILGLDGAGKTTILYRLQVGEVVTT----PTIGFNVEQVTYKNLKFQVWDLGG---------QTSIRPYWRCYYSNTDAIIYVVDSADRDRGISKDELLYMLREEELAGAILVVLANKQDMVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK....... 181
23 -23.200[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  16  18...................................................................................................................................................................RLLMLGLDNAGKTTILKKFNGEDIDTI----PTLGFNIKTLEHRGFKLNIWDVGG---------QKSLRSYWRNYFESTDGLIWVVDSADRQRQDCQRELQSLLVEERLAGATLLIFANKQDLIREALELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD... 184
24 -23.100[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  16  19...................................................................................................................................................................RILMVGLDAAGKTTILYKLKLGEIVTT----PTIGFNVETVEYKNISFTVWDVGG---------QDKIRPLWRHYFQNTQGLIFVVDSNDRDRVEARDELHRMLNEDELRDAVLLVFANKQDLITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASKA....... 181
25 -23.100[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  16  19...............................................................................................................................................................NKEMRILMLGLDAAGKTTILYKLKLNQSVVT----PTVGFNVETVTYKNIKFNVWDVGG---------QDKIRPLWRHYFTGTKGLIFVVDSADSNRSEARQELHRIISDREMRDCLLLVLANKQDLITDVLQLDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAKLK........ 184
26 -22.900[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  19  16...............................................................................................................................................................NKELRILILGLDGAGKTTILYRLQIGEVVTT----PTIGFNVETLSYKNLKLNVWDLGG---------QTSIRPYWRCYYADTAAVIFVVDSTDKDRSTASKELHLMLQEEELQDAALLVFANKQDQVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ....... 182
27 -22.800[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  15  18...............................................................................................................................................................QKEAKILFLGLDNAGKTTLLHMLKDERLVQHQ---PTQHPTSEELSIGKIKFKAFDLGG---------HQIARRVWKDYYAKVDAVVYLVDAYDKERAESKRELDALLSDEALATVPFLILGNKIDIPYAASEDELRYHL--EVFMCSIVRKMGYGEGFKWLSQYIN.......... 193
28 -21.700[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  17  14..............................................................................................................................................................KKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKTVGQNVATIPVDSKQLKFWDVGG---------QESLRSMWSEYYSLCHGIIFIVDSSDRERDECSTTLQSVVMDEEIEGVPILMLANKQDRQDRMEVQDHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIY 197
29 -20.500[R] COG2229 Predicted GTPase  ali follow..  14  5...................................................................................................................................................................KIIFTGPVGVGKTTAIAAISDEALVQTDAS-TTVAMDYGAISLDDTKVHLYGTPG---------QERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFF-LHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKPVFEIDARKEDDVKQLVSAMLFSIDPG........ 175
30 -20.400[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  16  29....................................................FPGHMAAATRAIRNRLKLSDLVIEVRDARIPLSSANEDLQSQMSAKRRII-ALNKKDLANPNVLNVIRFFKWTRHFEDCIAINAHSRSSVMKLLDLVELKLKEVIAREPTLLVMVVGVPNVGKSALINSIHQIAATVGPLPGVTQDIAGFKIA-HRPSIYVLDSPGVLVPSIPDIEGSVKDSVVGEERIAQYFLAILNIRGT.................................................................................. 252
31 -20.300[R] KOG0395 Ras-related GTPase  ali follow..  15  21...................................................................................................................................................................RMVVLGASRVGKSSIVSRFLNGR--EDQYTPTIEDFHRKVYNIRGDQLDILDTSG---------NHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAE--AYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPA.. 199
32 -19.900[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  18  52..............................................................................................................................................................RTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAV--TSMEPNEGTFVLKVKPVHLIDVPG---------HSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYNASVIKNKTPVLLCCNKTDKV-------------------TAHTKEFIRKQMEKEIDKLRVSRSAISTA. 211
33 -19.600[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  12  56...........................................................................................................................................................PFSTEVKPRILLMGLRRSGKSSIQKVVHKMSPNETLFLESTNKICREDVSNSSVNFQIWDFPG------QIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNDINFEVFIHKVDGLSDDHKIETQRDIHQRAFYLTSIYDHSIFEAFSKVVQKLIPQLPTLENLL 248
34 -19.400[T] KOG3886 GTP-binding protein  ali follow..  13  42...................................................................................................................................................................KVLLMGKSGSGKTSMRSIIFAN-ARDTRRLGATILDRIHSLQIGNLVLNLWDCGG----QDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYQSCLEAILQNSPKIFCLVHKMDLVQEDQRDLIFKEREEDLCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNL 252
35 -18.600[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  14  22...................................................................................................................................................................KLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTKFEIWDTAG---------QERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGA. 191
36 -18.300[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  15  11...................................................................................................................................................................KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDFLSKTMYLEDRRLQLWDTAG---------QERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGRFIETSAKAGFNIKPLFRKIAAALPGMESYSNTK. 180
37 -18.200[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  30......................................................................................................................................................PLSHEVISRQATINIGTIGHVAHGKSTVVKAISGDDPSCPRPECYRSCGSSMPDEFPVRHVSFVDCPG---------HDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKL--KHILILQNKIDLVKERQAKEQYEQILAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFT... 251
38 -18.200[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  15  14...................................................................................................................................................................KIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCDLHIWDTAG---------QEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQDAEAYAEYMETSAQDNVGISDAFESLTAKMIEHSRTRSTE. 183
39 -18.100[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  20  11...................................................................................................................................................................KIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVGFMIKTVEINGEKLQIWDTAG---------QERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEYLETSAKESDNVEKLFLDLACRLISEARQNTLV. 180
40 -18.100[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  17  11...................................................................................................................................................................KLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELDGKKLQIWDTAG---------QERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILIGNKCDCEDQRQVSFEQGQALADFLEASAKTNVNVDEAFFTLAREIKKQKIDAENE. 180
41 -18.100[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  17  10...................................................................................................................................................................KLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKKLQIWDTAG---------QERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLVGNKCDLTSQKVVSTETAKAFADFLETSAKNATNVEEAFMAMTAAIKTRMASQPAG. 179
42 -18.000[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  18  24...................................................................................................................................................................KILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTIYRNDKKLQIWDTAG---------QERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADFFEASAKDNINVKQTFERLVDVICEKMSESLDT. 193
43 -18.000[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  2...............................................................................................................................................................KRPLIIGVGGPVGAGKTMLIERLTRY-AAITNDIYTKEDARI-CDKHPDLQLLFLESGG------------DNLSATFSPDLVDFSIYIIDVAQG---------KIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKA-KDFFVTNLKTDEGLKSVADWIEKRLQLALLE..... 205
44 -17.900[R] KOG0394 Ras-related GTPase  ali follow..  16  1..........................................................................................................................................................MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRTLQIWDTAG---------QERFQSLGVAFYRGADCCVLVYDVNSMKSFENLEEFLIQASPSDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELY. 186
45 -17.800[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  16  14...................................................................................................................................................................KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGKFDVWDTAG---------QEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPN--HRDLVRVCENIPIVLCGNKVDVKERKVKAKTIRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQ...... 175
46 -17.700[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  15  10...................................................................................................................................................................KFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEFGSRVVNVGGKKLQIWDTAG---------QERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQFLETSALTGENVEEAFLKCARTILNKIDSGELD. 179
47 -17.700[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  15  10...................................................................................................................................................................KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDFKVKTISVDGNKLAIWDTAG---------QERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKFIEASAKTCDGVQCAFEELVEKIIQTPGLWESE. 179
48 -17.700[T] KOG4252 GTP-binding protein  ali follow..  18  11...................................................................................................................................................................KMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDERLMLWDTAG---------QEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSS--REKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAE. 179
49 -17.500[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  20  3..............................................................................................................................................................NQSEINIGLVGHVDHGKTTLTKALSGVWTD-MCYTTAEICERCGTETELLRKVSFVDAPG---------HETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMALDVIGV--KDVIVVQNKIDIVSKERALESYREIKEPIIPVSAQQGANIDILIETIEERIKTPKRDVD... 205
50 -17.500[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  16  13...................................................................................................................................................................KYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKLQIWDTAG---------QERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLD. 182
51 -17.500[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  12  1...................................................................................MAEPVSPLKHFVLAKKGITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQ----GYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHIT--NCFLSVEGTDGDLVLVDSPGT------DVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEWLSK--PNIFILNNRWDASASEPEYMEDVRR-NRIFFVSAKEVQEFQNFEQIFEECISQSAVKTKFE. 338
52 -17.500[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  17  12...................................................................................................................................................................KTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIGVEFATRNIVLDNKKAQIWDTAG---------QERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLVGNKTDLLHLRAVSTEEAQAFAAFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLE. 181
53 -17.400[R] COG1161 Predicted GTPases  ali follow..  20  76.....................................................DADFLRLLKEIGQHDALIVN---VVDIFDFNGSLIPNLHKL--GGNDLLMVANKRDVLPKSLKVGKLTAWLREQAASRSLKPKDILVTSAQNKDDVAELMEAIEYYRRGRDVYVVGVTNVGKSTLINAIIKSAITTSRFPGTTLDKIEIPLD---EDSALIDTPGIIHR.................................................................................................................. 243
54 -17.300[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  15  8...................................................................................................................................................................KYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKKLQIWDTAG---------QESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFARFMETSAKTAANVEEAFIDTAKEIYRKIQE..... 173
55 -17.300[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  15  11..............................................................................................................................................................SPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSS---------RPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKEAYNHFSKQYREVETSIQWSAQRLDQAKDVLYYAQKAV........... 177
56 -17.300[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  15  12...................................................................................................................................................................KLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDFKIRTMDINGQKLQIWDTAG---------QERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKR--LQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQFFETSAKEDKNVEPMFTCITSLVLTAKLANPQS. 180
57 -17.200[R] KOG1673 Ras GTPases  ali follow..  13  103...................................................................................................................................................................KISLLGDCQTGKTTFVVKYVGDE---QSFLEMTLNLMDKTFYVQGVSFSIWDVGG--------DEKRSKDHIPIACKDAVAILFMFDLTSRSTLNSVFG--YSQARKWNKTAIPILIGTKFDDTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRNL 277
58 -17.100[R] KOG1491 Predicted GTP-binding protein (ODN superfamily)  ali follow..  18  22...................................................................................................................................................................KAGIVGLANVGKSTFFQAITRCPGNPANYPFATIDPEEARVIVPSPRLTVYDIAGLTKGA-SAGEGLGNAFLSHI-RSVDSIYQVVRCFDDAEIIHVEGDVDPVRDLEIINQELRL----KDIEFAQKALEGAEK...................................... 169
59 -17.000[R] COG5258 GTPase  ali follow..  14  14............................................................................................KLTLGPQDVDRMAGQLKRRLAEGGGEAVYLIGVSNDGRPLGLPDEELVKALETLREMARRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRYKHEVLTGRTSAVSLRLLGFSDKLVLLVDVGGHERYLRTALRGL-------FSSQPDYVMLVVAANSGVQKMTKEHLGIAV----AIGIPVFVVVTRIDITPSEVFQKTVEEVVRPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYGGEF 339
60 -16.800[M] COG0481 Membrane GTPase LepA  ali follow..  17  2...............................................................................................................................................................KNIRNFSIIAHIDHGKSTLSDRLIQTSMDLERERGITIKAQSVTLNYKAKDLNFIDTPGHVDFSYE---------VSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM----NLEVVPILNKIDLPAAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDPNAPL 191
61 -16.800[J] COG0050 GTPases - translation elongation factors  ali follow..  13  3........................................................................................................................................................KEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVNAPEEKARGITINTSHVEYDTPARHYAHVDCPG---------HADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQV-----PYIIVFMNKCDMVDDEELLELVEMEVRELLSVRGSALKALEGEAEWEAKIIE.......... 191
62 -16.700[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  15  470...................................................................................................................................................................KVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVIDFRNKVVVVDGTRVKL-DTAG---------QERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVKRGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDD. 641
63 -16.700[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  18  11...................................................................................................................................................................KFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDFREKRVVYRASHLQLWDTAG---------QERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEYFETSAANGTNISQAIEMLLDLIMKRMERCVDK. 191
64 -16.400[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  16  5...................................................................................................................................................................KCVVVGDGAVGKTCLLLSYTTNA---GEYILTVFDTYSTNVMVDGRPINLSDTAG----------QDDYDQFRHLSFQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRESRLQPVSCSALTQIGLKQVFDEAIRTGLTPPQTPQTR. 186
65 -15.900[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  20  40...............................................................................................................................................................DKIRNFGIVAHVDHGKSTLADRLLEMKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAE---------VSRSLAVCDGILLLVAANQGVQAQTIANFWLAFE----KNIQIIPVINKIDLPGATQLKNLFEFNPEECLHISAKSGLNVDKVLEAIIDRVPAPTAIIDAPF 222
66 -15.700[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  15  43.......................................................................................................................................................DEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMTISSAHVEYETANRHYAHVDCPG---------HADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQV-----KQIVVYINKVDMVEPDELLSEYGFDGDNTPIVSGSALCALEGREPEI............... 226
67 -15.700[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  14  34.........................................................................................................SMFSWLGGDSSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDALVVDKQFRALSGFGNAFLNR-ESVTIVDTPGILSGEKQRIDR-FTGVLEWFAERVDRIILLFDAHK----DISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMR.......................................... 265
68 -15.500[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  15  21...........................................................................................................................................................AQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYE--GITIDVAYRYFSTEKRKFIIADTPGHEQ---------YTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLL-----KHLVVAINKMDLVDSEETFTRIREDYLTFVPLSALEGDNVASQSESM............... 220
69 -15.500[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  15  11...................................................................................................................................................................RLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKD-KLQLWDTAG---------QERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFVETSARSGANVEEAFRMVTQEVYARIRSGEYKA 186
70 -15.300[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  20  2.........................................................................................................................................................KIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIPA--GVTIDLAHRKFETDKYYFTLIDAPGHRD---------FVKNMITGTSQADAAILVISAREGEGVMEQTREHAFL-ARTLGVPQMVVAINKMDATSPPYSEKRYNEVKADAVPISGYKGDNVTKPSPNM............... 204
71 -15.200[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  17  3.............................................................................................................................................................KEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDK--GITIDIALWKFETAKYYITIIDAPGHRD---------FIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQKQLIVACNKMDSTEPPFSEARFTEITNEVVPISGFNGDNMLEVSSNM............... 208
72 -15.100[R] KOG1533 Predicted GTPase  ali follow..  15  3...................................................................................................................................MNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIRFLEKSGVRLCALHLADSL-SDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFDLVSFVPLAVENKESMMKVIQMVDAANG.......... 282
73 -14.900[K] KOG1534 Putative transcription factor FET5  ali follow..  11  6....................................................................................................................................................................AFVCGVASSGKSTFCGALMGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIE-THVPILPALIRHLQVTLNFRPCAVYLLESQ-VDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKD. 263
74 -14.400[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  19  3....................................................................................................................................................................IVTSGHVDHGKTALLKALTGTSTA-EKKRGMTIDLGYAYLPLENKVLGFIDVPG---------HEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILR----LQFHEIIVVITKADRTNSAQIESLIQTIKQNYFVTSAETGQGISELRHYLANLAELADTQKPFRY 173
75 -14.200[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  14  3...............................................................................................................................................................ENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDR--GITILAKNTAIKWNGYNINIVDTPGHADFGGE---------VERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFK----AGLRPIVVVNKIDRPGADQIFDLFDNLGATDEQLDFPIVYASA..................... 167

FFAS is supported by the NIH grant R01-GM087218-01
1 3 3 8 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. cd-hit: a fast program for clustering and comparing large sets of protein or nucleotide sequences. Bioinformatics. 2006 May 26;