current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG1160 Predicted GTPases, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MATPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGHAHIAGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKVHLAVEKFSVIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTSLLTRILQMATDEHQPPMIGGRRIKLKYAHPGGYNPPIIVVHGNQMDKLPDSYKRYLSNYYRKSLKIIGSPIRLLFQEGSNPFAGRKNKLTPNQLRKRKRLMKFIKKAKRLast
1 -133.000[R] COG1160 Predicted GTPases  ali  100  1MATPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGHAHIAGYDFIVIDTGGIDGTEEGVEEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRKRGKVHLAVEKFSVIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTTSLLTRILQMATDEHQPPMIGGRRIKLKYAHPGGYNPPIIVVHGNQMDKLPDSYKRYLSNYYRKSLKIIGSPIRLLFQEGSNPFAGRKNKLTPNQLRKRKRLMKFIKKAKR 504
2 -44.000[R] KOG2486 Predicted GTPase  ali follow..  12  7.................................................................PRFHLSILAKPSFSLSSSHFSFLNPKPSVTVSRTLFSFASKSNLATVEPIPLSVSDSTDLDDAPVEIALDKLFIPPETDISGEDSASLTTRILKGSNIVLSKYARDAQVVQADYVKSSVKTEDCP---------------------ADGLPEFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCIN--HFRINDKWYLVDLPGYGYASAPHELKQDWNTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH................................................................................................................. 318
3 -42.500[R] COG1084 Predicted GTPase  ali follow..  18  1MIIPTVP--------TDELLDKGFRRARKA---ASLKRSSKIPGQKKAKVIESTRVQT-----ACQVIRDRLKMIIQRIPDIESLPEFYIDVTVGVDELKKSLGAL--NWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTVDLDA---------------------------------------FTVVIAGFPNVGKSTLLRTLTGA-EPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPV--EDMNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIDIPVVTVFNKMDLAENVKYLEEYINM--------VEDPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN............................................................................................................. 335
4 -40.900[R] COG3596 Predicted GTPase  ali follow..  13  39...PVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVG-ESGVRDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIGEARHKMLFVISQSDNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVALLQHPF------------------------------------------RTWVAREQARDDFGETVDTILDTVSTFPLIPAPVRTIIQAVRSSVVSVAR........................................................................................................................................................................................................................................ 282
5 -33.400[J] KOG1191 Mitochondrial GTPase  ali follow..  20  144.....VGIVRLSGPKAVEVARRVFRSAKK-VVDSNGNVVDEVLAVPMLAPRSYTREDVGSEVCLRRVLRTCVEAGARLAEPGEFTLRAFLNGRLDLSQAE-NVEKLISAKSSAAADAALEG-----------------------IQGGFSSLVKSLRAQCIELLTEIEARL---DFEDEMPPLDIESVINKITSMSQDVESALDTANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEANVTVRGVPITLLDTAGIR---ETNDIVEKIGVERSETAAKVADVIIMAVSAVEGWTEEDTELLRKIQSLKQPMILVMNKIDCAPPGSCDQLEDQRKKE---EVFHKSVFTSAVTGQGIEELEDAILEILGLDRVPTGGHQW........................................................................................................... 545
6 -32.400[R] COG1159 GTPase  ali follow..  20  11.....IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGPYQAIYVDTPGLMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRW-TPDDEMVLNKLRD-GKAPVILAVNKVDNVQEKVDLLPHLQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMASEREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMF...................................................................................................................................................................................................................................................... 269
7 -31.300[R] COG0486 Predicted GTPase  ali follow..  19  30.....IGILRVSGPKAVEVAHTVLGKCPK-FKDSDGNVLDQGIALYFKAPHSFTGEDVGGQVVLDLLLKRILQLEGLRLARPGEFS--FLNDKLDLAQAE-AIADLIDASSEQAARSALKS-----------------------LQGEFSNKVNQLVDSVIYLRTYVEAAIDFPD--EEIDFLADGKIEAHLNDIITQLDHVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLR---EATDEVERIGIVRAWSEIEQADRILLMLDSTEADNQDLEKVRSEFLTSNIPVTIVRNKADLSGENEGIVEQNG----------YTVITLSAKTQQGIALLREHLKQSMGYQTNMEGGFLARRRHLEALEQ................................................................................................. 409
8 -29.900[R] COG0218 Predicted GTPase  ali follow..  22  22...................................................................................................................................................................................................................QDELPEIALAGRSNVGKSSFINTMLNRKNLATSGKPGKTQ---LLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKADKIPRGKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL....................................................................................................................... 195
9 -26.600[E] COG4917 Ethanolamine utilization protein  ali follow..  19  1..MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDK------------GDIDTPGEYFNHPRWYHALIT----TLQDVDMLIYVHGANDPESRLPAGLLDIG---VSKRQIAVISKTDMPDADVAATRKLLLETGPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE....................................................................................................................................................................................................................................................................................................................................... 159
10 -21.600[P] COG0370 Fe2+ transport system protein B  ali follow..  14  1MSQNTYCILGNPNTGKTSLFNALTGSYEY-VGNWSGVTVEKKVG--TLRSKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFDCMLNIVDSSQ--IERNLNLTVQLLE-YGAPVVMGLNMIDVAAGRGIHLNIQNLA--PILPVVARSGKGTEDILSTLSEKHVAPSKNEVTEAFLTSNSAFEQLQQIRAELESELNGKLENHFHQVRASYIHDICLTSVEYTRNSDIPLSDKL---DKIFTHKLLGIPIFLGIMWLIFQITFTWVGAPLSDMLDGFIGGSLTDWVTSFLTTIGASGFIIDLVADGIIAGVGGVLVFVPQIL-----IFFFISVLE--DSGYMARIAVVMDRVMEIFGLNGKAFIPMIIGFGCNVPGIMAARSIEESKERTLTILVSPFMS...................................................................................................... 430
11 -20.800[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  21  171.........................................................................................................................................................................................................................VLICGYPNVGKSSFMNKVTRAD---VQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQALFHSIKSMNKPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMQVLLKMSTLTDEGVMSVKNAACERLQRVEAKMKSKKINDHLNRFHVAIPKPRDSIERL...................................................................................... 384
12 -18.800[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  19  34.....................................................................AAATRAIRNRLKLSDLVIEVRDARIPLSSANEDLQSQM---SAKRRIIALNKKDLANPNVLNVRHFESSKQDCIAINAHSRSSVMKLLDLVELKLKEVIAR------------------------------------------EPTLLVMVVGVPNVGKSALINSIHQLKRATVGPLPGVTQDIAGFKIA-HRPSIYVLDSPGVDIETGLKLALSGSVKDSVVGEERIAQYFLAILNIR.................................................................................................................................................................................................... 250
13 -17.900[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  21  19....RILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSV----QSQGFKLNVWDIGG--------QRKIRPYWKNYFENTDILIYVIDSRKRFEETGQELAELLEEESCVPVLIFANKQDLLTAAPASEIAEGLNLHTIQSCSALTGEGVQDGMNWVCKNVNAKKK............................................................................................................................................................................................................................................................................................................................................... 182
14 -17.800[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  19  22....KILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEEL----SIGKIKFKAFDLGG--------HQIARRVWKDYYAKVDAVVYLVDAKERFAESKRELDALLSDEATVPFLILGNKIDIPYAASEDELRYHLGLTNVFMCSIVRKMGYGEGFKWLSQYIN................................................................................................................................................................................................................................................................................................................................................... 193
15 -17.600[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  20  19....RILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETV----EYKNISFTVWDVGG--------QDKIRPLWRHYFQNTQGLIFVVDSRDRVVEARDELHRMLNEDRDAVLLVFANKQDLPNAMNAAEITDKLGLHSIQSTCATSGEGLYEGLDWLSNNIASKA................................................................................................................................................................................................................................................................................................................................................ 181
16 -17.600[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  17  18....RLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTL----EHRGFKLNIWDVGG--------QKSLRSYWRNYFESTDGLIWVVDSRQRMQDCQRELQSLLVEEAGATLLIFANKQDLPGALSSNAIREALELDSIQGCSAVTGENLLPGIDWLLDDISSRIFTAD............................................................................................................................................................................................................................................................................................................................................ 184
17 -17.600[R] COG2262 GTPases  ali follow..  24  196.DVPTVSLVGYTNAGKSTLFNRITEAR-VYAADQLFATLDPTLRRIDVDVGETVLADTVGFIRHLPHDLVAAFKATLQETRQATLLLHVIDAADVRVQENIEAVNTVLEEIDIPTLLVMNKIDMLEDFEPRIDRDEENKPIRVWLSAQTGAGIPQLFQALTERLSG.................................................................................................................................................................................................................................................................................................................................................. 363
18 -17.600[R] COG1161 Predicted GTPases  ali follow..  20  76....................................................................DADFLRLLKEIGQHDALIVNVVDIFDFNGSLIPNLHKLT---GGNDLLMVANKRDVLPKSLKVGKLTALKPKDILVTSAQNKDDVAELMEAI-------------------------------------------------EYYRRGRDVYVVGVTNVGKSTLINAIIKSDVITTSRFPGTTLDKIEIPL---DEDSALIDTPGIIHRGQIAHYLEDLKYVSPRKEIKPKTYQLLFFGGLARFDFISGERQGMTAYFDNEINVHRTKLEGATEFYEKHKGELL......................................................................................................................................................... 325
19 -17.500[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  20  19....RILILGLDGAGKTTILYRLQVGEVVTTIPTIGFNVEQV----TYKNLKFQVWDLGG--------QTSIRPYWRCYYSNTDAIIYVVDSRDRIGISKDELLYMLREEAGAILVVLANKQDMDGCMTVAEVHHALGLENIFKTSATKGEGLDQAMDWLSNTLQSRK................................................................................................................................................................................................................................................................................................................................................ 181
20 -17.500[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  18  23....RILMLGLDAAGKTTILYKLKLNQSVVTIPTVGFNVETV----TYKNIKFNVWDVGG--------QDKIRPLWRHYFTGTKGLIFVVDSSNRISEARQELHRIISDRRDCLLLVLANKQDLPGALSPAQITDVLQLDKVQPTCALTGDGLLEGLAWLSQNAKLK................................................................................................................................................................................................................................................................................................................................................. 184
21 -17.300[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  20....RILILGLDGAGKTTILYRLQIGEVVTTKPTIGFNVETL----SYKNLKLNVWDLGG--------QTSIRPYWRCYYADTAAVIFVVDSKDRMSTASKELHLMLQEEQDAALLVFANKQDQPGALSASEVSKELNLVEIVASSAIKGEGITEGLDWLIDVIKEEQ................................................................................................................................................................................................................................................................................................................................................ 182
22 -17.300[R] KOG2484 GTPase  ali follow..  19  138.....................................................................KQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGPGNKRLVLVLNKADLVPRENLNNKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMLGN--------------------CRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELD---SKIKLIDCPGI-------------------SGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTM--YDITNYDTFEEFFAKKAARMGKF-----------LKKGVPDVVAAARSVLNDWNT----------------------------KIKYCTQ----PP......................................................................... 420
23 -17.100[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  15  22....ELTLVGLQFSGKTTFVNVISGQFAEDMIPTVGFNMRKI----TRGNVTIKVWDIGG--------QPRFRSMWERYCRGVNAIVYMVDALDKLEASRNELHSLLDKPAGIPVLVLGNKRDLPGALDETGLIERMNLSSCYSISCKEKDNIDITLQWLIQHSKSQSR............................................................................................................................................................................................................................................................................................................................................... 186
24 -16.900[R] KOG0410 Predicted GTP binding protein  ali follow..  14  115.........................EKAYLVGVERKGDGECLFNIEESLEELEQLADTAGLAVVGSTYQKLASPNPRTYIGSGEIKSAINALDVETVIFDDELSPGQLRNLEKAFGGDVRVCDRTA---------------ILDIFNQRAATHEAALQVALAQMEYQLPRLTMGEKQIEVDKRILRTQIGVLKKELESVRKHRKQYRSRRVAIPVPVVSLVGYTNAGKSTLLNQLTGAN-VLAENRLFATLDPTTRRVQMNGKEFLLTDTVGFIQK---TTLVAAFRA--TLEEIAESSLLVHVVDISHPLAEQQIEAVEKVMSESIPKLVVWNKVDRVDDPQKVKLEAE--------ETGDTICISALTGEGLDDFCNAVHEKLKDSMVWVEA----------------PFDKGDLLSTIHVKETEYTENGTLIRAHVPLRFAQLLKPMRHLVKDTSISQRG......................................... 540
25 -16.300[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  52...................................................................................................................................................................................................................RTKSNTVLLSGLSGSGKTVLFYQLRDGSSSMEPNEGTFVLHNENNTKKGKVKPVHLIDVPG---HSRLISKLEEY--------LPRAAAVVFVVDALENIRAASEYLYDILIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIEGEVFSFSHCHNKVTTGETDQVQEFIREHVKP.............................................................................................. 260
26 -16.000[R] KOG1424 Predicted GTP-binding protein MMR1  ali follow..  14  116..........RPNWNQNTTPEELKQAEKD--------------NFLEWRRQLVRLEEEQKLILTPFERNLDFWRQLWRVIERSDIVVQIVDARNPLLFRCEDLECYVKEDANKENVILINKADLLTAEQRSAMYFEKEDVKVIFWSALAGAIPDGPKEEDCSQDWKESSTADSEARSRKTPQKRQIHNFSHLVSKQELLELFKELHTGRKVKDGQLTVGLVGYPNVGKSSTINTIMGNKKVSVSATPGHTKHFQTLYVE---PGLCLCDCPGL---------------VMPSFVSTKAEMTCSGILPIDQMRDHVPPVSLVCQNIPRHVLEATYGINIITPREDEDPHRPPTSEELLTAYGYMRGFMTAHGQ----------------QPRSARYILKDYVSKLLYCHPPPGRDPVTFQHQHQRLLENK-------NKKAKQIENIVDKTFFHQENVRALTKGVQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEK. 648
27 -15.800[R] COG1163 Predicted GTPase  ali follow..  20  68.....VGFVGFPSVGKSTLLSKLTGTESE-AAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKD-GRGRGKQVIAVARTCNLLFIILDVNKPLHHKQKELEGVGIRLNKTPPDILIKKKE............................................................................................................................................................................................................................................................................................................................................................................................. 186
28 -15.600[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  21  67.....IGFVGFPSVGKSTLLSNLAGVYSE-VAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKD-GKGRGRQVIAVARTCNLILIVLDVLKPLGHKKNELEGFGIRLNSKPPNIGFKKKD............................................................................................................................................................................................................................................................................................................................................................................................. 185
29 -15.600[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  13  16....RIVVVGEKGSGKSSLIMAAARNT--FHPNIPSLLPYNLPSEFFPDRIPATVIDTSS--------RPEDKGKVVKEVRQADAIVLTFAFDETLDRLSKYWLPLFRQLEVRPIIVAGYEVDSIEQITSALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAVIDPVGPVFDQENNVLKPRCIAAFPSDDPSSAVRVTRKRVLDRKEKKSERKVVQCFVFGPKNAGKSALLNQFIGRSYD-TDEHYAVNMVKEPGVISDTDKTLVLKEVRI-----------KDDGFMLSKEALAACDVAIFIYDSSDEYS---NRAVDMLAEYVFPCLMVAAKTDLDPFPVAIQESTRVTQD---IGIDAPIPISSKLG-DVSNLFRKILTAAENPHLNIPEIESKK......................................................................................................... 611
30 -15.500[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  15  19....SILILGLDNAGKTTFLETLKKEYSLAFKALEKITVGQNVATIPVDSQILKFWDVGG--------QESLRSMWSEYYSLCHGIIFIVDSRERLDECSTTLQSVVMDEEGVPILMLANKQDRQDRMEVQDIKEVFNKIRVLPISALTGEGVKDAIEWMIVRLERNKKSRPP........................................................................................................................................................................................................................................................................................................................................... 195
31 -15.300[R] KOG2423 Nucleolar GTPase  ali follow..  20  159....................................................................SNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKKPHKHLVTVINKVDLVPTWVTRKGELSKEMPTIAFHASINNSFGKGAVINLLRQFAK------------------------------------------LHPDRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVML---MRRIYLIDSPGV-------------------QGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHL--RRQYGIPEFTDVDDFLTKIAIKQGRL-----------LKGGDPDIVAVSKVVLNEFQR----------------------------KLPYFVP----PP......................................................................... 419
32 -15.300[M] COG0481 Membrane GTPase LepA  ali follow..  19  3.NIRNFSIIAHIDHGKSTLSDRLIQTCGGLLERERGITIKAQSVTLNYKAKDLNFIDTPG--------HVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM-NLEVVPILNKIDLPAADEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDPNA........................................................................................................................................................................................................................................................................................................................................... 189
33 -15.300[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  13  6............................................................................................................................................SPLKHFVLAKKGITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSII-----GEVLSRRHMKVAFFGRTSSGKSSVINAMLWDK-VLPSGIGHITNDGDKAYLMTEGSDLVLVDSPGTDVTTELDSWIDKF--------CLDADVFVLVANSESTLMNTEKHFFHKVNEWLPNIFILNNRWDASASEPEYMLVEELKVANALEAQNRIFFVSAKEVQEFQNFEQIFEECISQSAVKTKFEQHTIRAKQILATVKNIMDSVNLAAEDKRHYSVEEREDQIDRLDFIRNQMNLLTLDVKKKIKEVTEEVANKVSCAMTDEICRLSVLVDEFCSEFHPNPDVLKIYKSELNK 447
34 -15.200[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  14  192....KTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTLFRISQPGGRLNQ-KKHS--------VASFRANCPCKQETDNGLALLPSGSRKPSISVAT-PLASGSPTRRESLVKPQHITPGQLPPKTLDIASDDSDDDGYPKRRPSVIVHQRQQSISQQPLLPEYMTSASIFRDHAPQTSQSQSQSNAGRALIRMISSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVVVVDGTRVKL-DTAGQERFRSV-----------THAYYRDAHALLLLYDVTNKTTYDNIR-LGEIREYAQEIVLIGNKADC--SGSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSRGYE................................................................................................................. 637
35 -14.900[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  12  133.....VYIQAVAGLGEAGAARQLDGMRDVLIQVPVGTVPPQKVRELVEREMRKDNNATLRSILGSTAVNLSVSSGSHRKKIQLYRHEMAESWLFKDKAKEYHENKDWFKDLHKKMEAYDHSLEQSELFNDQFPLAGLDLNQCLLKGGQGGLGNMHFLTNLIRNPRFSKPGRNGLEQHFLFELKSIAD------------------------------LGLIGLPNAGKSTILNKI-SNAKPKIGHWQFTTLSPTIGTVSLGFDVFTVADIPGIIQGASLDKGM-----LEFLRHIERSNGWVFVLDLSNKNPLNDEEVGTLEKVKTKNILIVCNKVDIDAEKSESFAKYLQVEKFSKSQEWDCVPISALREKT................................................................................................................................... 499
36 -14.600[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  20  8...................................................................................................................................................................................................QIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQQGITIDVAYRYFSTEKRKFIIADTPG-----------HEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGKHLVVAINKMDLVSEETFTRIREDYLTFAGQLPGNLFVPLSALEGDNVAS................................................................................................................................ 215
37 -14.500[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  23  65.....VALIGFPSVGKSTLLTMLTGTHSE-AASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASE-GKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQKELEAVGLRLNKTPPQIYFKKKK............................................................................................................................................................................................................................................................................................................................................................................................. 183
38 -14.500[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  16  41.KIRNFGIVAHVDHGKSTLADRLLEMCGAVVERERGITVKAQTAALRHRGYLLNLIDTPG--------HVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEK-NIQIIPVINKIDLPGADTQLKNLFEFNPEECLHISAKSGLNVDKVLEAIIDRVPAPTAIIDAPFRSMIFDSYFDHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSEVGVMRPEMVKCTELRAGQVGYLVCNMRTVVGETLFAETTSRDSVKTFAEIK-VYAGLFPVETSDYESLKQAVERLCLNDPSVTVIPDSSKALGLGWRIGFL....................................................................................................................................................................................... 376
39 -14.500[R] KOG0395 Ras-related GTPase  ali follow..  15  21....RMVVLGASRVGKSSIVSRFLNGR--FEDQYTPTIEDFHRKVYNIRGDMYQILDTSG--------NHPFPAMRRLSILTGDVFILVFSLQKQILEVKSCLKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVS-FEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRK....................................................................................................................................................................................................................................................................................................................................... 203
40 -14.100[J] KOG0458 Elongation factor 1 alpha  ali follow..  13  170.....FVVLGHVDAGKSTLMGRLLYDLNIVNQSQRGVTVSICTSHFSTHRANFTIVDAPG--------HRDFVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHM-HNLIIAMNKMDNVDWSQQRFELVDIGFFE-VPISGFSGEGVYKLMSTLENAAFKISKENEGINKDDPFLFSVLE----------------------PSKKTSNDLALVSGKLESGSIQPGESLT--DKIQVGSQQGQSTNHEETDVAIKGDFVTL-KLRKAYPEDIQNGDLAASVDYSSIHSAQCFVLELTTFDMNRPLLPGTPFILFIGVKEQPARI-LISFIDKGNTASKKKIRHLGSKQRAFVEIELIEVKRWIPLLTAHENDRLGRVVLRKDGRTIAAGKISEITQ...................................................................................................... 611
41 -14.100[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  14  3................................................................................................................................................................................GGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGLERNITIKLECYRSCGSSMPDEFLVRHVSFVDCPG-----------HDILMATMLNGAAVMDAALLLIAGNESCTSEHLAAIEIM----KHILILQNKIDLVKERQAKEQYEQILAFVQVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTS.............................................................................................................. 252
42 -14.000[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  21  7........................................................................................................................................................................................................................NIAIIAHVDHGKTTLVDKLLKLSGTLQEKERGITILAKNTAIKWNGYNINIVDTPG-----HADFGGE------VERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLRPIVVVNKIDRPGARPDWVIDQ........................................................................................................................................................... 143
43 -13.900[R] COG5258 GTPase  ali follow..  14  5.................................................................................................ESEDGNVEYKLTLGPQDVDRMAGQLKRRLAEGGGEAVYLIGVSNDGRPLGLPDEELVKALETLREMARRVGASLYILRVSE---------------GIRGKVAEVLLRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGR---LDDGKGLARSYAAEVYKRSDKLVLLVDVGGHER------------LRTALRGLSQPDYVMLVVAANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMPGVAPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYGGE............................................................................................................. 338
44 -13.900[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  12  10.....IVVIGHVDSGKSTTTGHLIYKCGGIDKRTRGITIDIALWKFETAKYYITIIDAPG--------HRDFIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHA-KQLIVACNKMDSTEPPFSEARFTEIGYNPKVPISGFNGDNMLEVSSNM-----PWFKGWAVERKEGNASGKTLLEALDSIIPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNVTTEVKSVEMHHESLPEAVPGDNVGF-NVKNVSVKDIRRGSVCSDSKQDPAKEARTFHAQVIIMNHPGQISNGYTPVLDCHTAHIACKFNLKEKVDRRTGKKVEDFPKFLKSG--DAGIVELIPTKPLCVESFTDYAPLGRFAVRDMRQTVAVGVIKSVEKSDGSSGKVTKSAQKAAP..................................................................................... 460
45 -13.900[R] COG0536 Predicted GTPase  ali follow..  13  84...........................................................................................................................................GKDLVLEVPPGTVVLNEKGETLADLTSVGMKFIAAAGGNGGLGNAALASKARKAPGFALIGEPGEAHDLILELKSMADVGLVGFPSAGKSSLISVMSAAKPKI-GDYPFTTLQPNLGVVNVGHETFTMADVPGLIPGASEGKGL-----LDFLRHIERTSVLVHVVDTATMDPGRDDEDTGLGDLSQRPRLVVLNKADVPEAEEL---AEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIKPKAVDHRTKGQFQ------IKPDPEVQGGFIITGEKPERWDEAVGYLIEDGLRKAGAHVGANVTIEWEPMTTAGDDPVLTGRGTDVRLEQTSRISAAERKR 474
46 -13.800[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  15  42...........................................................................................................................................................................................................ADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHAD------------IKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGKQIVVYINKVDMVEPDMIELVEMEMRELLSEYGFDNTPIVSGSALCALEGREPEI--------GLNSITKLMEAVDSYITLPERKTDVPFLMAI.................................................................................... 257
47 -13.800[R] KOG1673 Ras GTPases  ali follow..  17  103....KISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGG--------EKRSKDHIPIACKDAVAILFMFDSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDFVRVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARLFNLPWKIDRN.......................................................................................................................................................................................................................................................................................................................................... 276
48 -13.800[J] COG4108 Peptide chain release factor RF-3  ali follow..  10  14.KRRTFAIISHPDAGKTTITEKVLLFGRAIMEKERGISVTTSVMQFPYGDCLVNLLDTPG--------HEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLR-DTPIVTFMNKLDREIRDELMDEVENELKIACSPITWPIGKGVYHIHRDETILYTSGQGHTIQEERIIKGLDNPELDQAVGADLAAQLREELELVLGASHEFDRELFLQGELTPVFFGTALGNFGVDHMLDGLTQWAPSPMPRQAAERVVEASEEKFTGFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMN--HVRLGKQVNISDAVTFMAGDRARIIGLHNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRIRLRDPLKQKQLLKGLVQLSEEGAVQVRPLQNNDLIVGAVGVLQFDVVVSR-LKSEYNVEAIYEGVNV------------ATARWVEC................................................... 478
49 -13.300[R] COG2229 Predicted GTPase  ali follow..  16  1MRENKIIFTGPVGVGKTTAIAAISDEADMTLDRKRNTTVAMDYGAISLDDTKVHLYGTPG--------QERFNFMWEILSQGSMGLVLLLDNANPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYL---PVFEIDARKEDDVKQLVSAMLFSIDP.................................................................................................................................................................................................................................................................................................................................................. 174
50 -13.200[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  6....IIGVGGPVGAGKTMLIERLTGYSMAAITNDIYTKEDA-EMCDKHPDLQLLFLESGGDNLSATFSPDL-----------VDFSIYIIDVAQG-----EKIPRKGGQGMIKSDLFIINKVDLAPYVGANVEVMKADTLDFFVTNLKTDEGLKSVADWIEKRLQLALLEE............................................................................................................................................................................................................................................................................................................................................. 206
51 -13.200[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  12  181...PVVTIMGHVDHGKTTLLDKF-RKTQVAAVETGGITQHIGAFLVSLSGEKITFLDTPG--------HAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHA-KDAQVPIILAVNKCDEADPEKVKKELLAYDV-QAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVE---------------------------------------TVIESFTDKGRGLVTTAIIQRGTLRKGSVAGKCWAKVRLMFDENGKTID-VGITGWRDLPSAGEEILEVESEPRAREVYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKYGHLLWKKRSILRFLERKEQIPLKPKEKRERDSNVLVIIKGDVDGSVEAILNIIDTY--DASHECELELVHFGVGDISANDVNLAETFDGVIYGFAAKKGVKIKLHKIIYRLVEDLQEELSSRLPCAVEEHP-VGEASILATFSVTEGK............................ 638
52 -12.900[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  17  14....KLVLVGDGGTGKTTFVKRHLTGEEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAG--------QEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPHRDLVRVCENIPIVLCGNKVDVKERKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKL.................................................................................................................................................................................................................................................................................................................................................... 170
53 -12.800[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  13  13.....LITIGHVDHGKSTLVGRLLYEHGEIPAHIRGVTIDLAHRKFETDKYYFTLIDAPG--------HRDFVKNMITGTSQADAAILVISAREGVMEQTREHAFLARTLGVPQMVVAINKMDATSPPYSEKRYNEVGFKDIVPISGYKGDNV-----------------TKPSPNMPWYKGPTLLQALDAFKVPEKPINKPLRIPVEDVYSITGIGTVPVGRVETGVLKPGDKVIFLPADKQGDVKSIEMHHEPLQQAEPGDNIGFIAKNDIKRGDVCGHLDTPPTVVKAFTA-------IIVLNHPSVIAPGYKPVFHVHTAQVACRIDIVKTLNPKDGTTLKEKPDFIKNG--DVAIVKVIPDKPLVIEKVSEIPQLGRFAVRDMGQTVAAGQCIDLEKR..................................................................................................... 427
54 -12.800[R] KOG0394 Ras-related GTPase  ali follow..  17  9.......................................................................................................................................................................................................................LKVIILGDSGVGKTSLMNQYVNKKSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAF-----------YRGADCCVLVYDVNSMKSFENLN-ASPSDPENFPFVLIGNKVDVDDGNSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEE................................................................................................................. 182
55 -12.700[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  18  1.......................................................................................................................................................................................................................MIIVTSGHVDHGKTALLKALTGTAHLPEEKKRGMTIDLGYAYLPLENKVLGFIDVPGHEK------------LSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQHEIIVVITKADRTNSAQIESLIQTIKQDYSFLRNANYFVTSAETGQGISELRHYLANLAELADTQ................................................................................................................. 168
56 -12.600[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  12  34....RYGLCGRNGAGKSTLMRAIANGQLDGFPDKDTLRTCFVEHKLQGEEGDLDLVSFIALDEELQSTSREEIAAALESV-DEERRAQTVGSLSGGWKMKLELARAMLQKAD--ILLLTNHLDVSNVKWLEEYLLEHTDITSLIVS--HDSGFLDTVCTDIIHYENKKLAYYKGNLAAFVEQKPEAKSYYTLTDSNAQMRFPPPGILTGVKSNTRARVACLGPNGAGKSTLIKLLTGE----LVPNEGKVEKHPNLRIGYIAQH----------ALQHVNEHKEKTANQYLQWRYQFGDDREVLLKESRKISEDEKEMMTKEIDIDDGRGKRAIEAIVGRQKLKKSFQYEVKWKYWKPKYNSWVPKDVLVEHGFEKLVQKFDDHEASREGELIPSVITKHFEIANHTPLGSLSGGQLVKVVIA-GAMWNNPHLLVLDEPTNYLDRDSLGALAVAIRD---WSGGVVMISKGSAQVDQSKFEDGGNADAVGLKASNLAKPSVDDD 579
57 -12.500[J] KOG0468 U5 snRNP-specific protein  ali follow..  15  5......................................................LYDEFGIGPDLDSDEEDEQSIYGQPDVQDDPEDAMDEDEVEPQEDEDKEVTAVVLHEDKRYYPSAVEVYGPDVETIVQE-----------------EDAQPLDKPLIEPVKKLKFQIKEQDMQE-------------------TTYDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFEQERGCSIKATPVTLVLQDVKLNIFDTPG---------------SDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAITVCINKIDRLILELKLPPQD........................................................................................................................................................... 275
58 -12.400[J] COG0050 GTPases - translation elongation factors  ali follow..  11  14....NVGTIGHVDHGKTTLTAAITT-DNAPEEKARGITINTSHVEYDTPARHYAHVDCPG--------HADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVYDFPGDDLPVVRGSALKALEGEAEWEAKIIELAGYLDSYIPEPERAIDKPFLLP-------------------EDVFSISGRGTVVTGRVERGIVKVGEEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVG-VLLRGIKREDIERGQV--LAKPGSIKPHTTFESEVYILSKDEGFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVI........................................................................................................................... 393
59 -12.100[J] COG0480 Translation elongation factors (GTPases)  ali follow..  11  9.KVRNIGIAAHIDAGKTTTTERIVHEGTAVTDWMDGITITAAAISTSWKDYQINIIDTPG--------HVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQA-DRYKVPRIAFINKMDRTGANYRVHEQMRDRLRAAIQLPIGSENDFKGIVDLVRKRAYMYNNDQGTDIEETDIPADLQDQVEEYYTKLVEAVAETDDDLMSKYFDGEPLTEEEI-RSALRKGTIAGTIVPVLCGSAFKNKGVQLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPYGRLTFVRVYSGVLKKGSYVLNATKNKKERISRLV------------LMKADDRQDVEELRAGDLGAALGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVE--------PKTKNDMDKLSKAQSLSEEDPTFRVNVDPEAGMGELHLEILVDRMLREFKVEGAP-QVAYRETIRKPVTNVEGKFIRQSGGKGQ.......... 503
60 -12.100[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  23  91.AKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFFRALSGFGNAFTIVDTPGILSGEKQRIDRFTGVLEWFAERVDRIILLFDAKLDISDEFKRCIEALAGNEDK-IRIVLNKSDMVDHQQLMRVYGAL............................................................................................................................................................................................................................................................................................................................................................................... 270
61 -12.100[T] KOG3886 GTP-binding protein  ali follow..  12  40..KKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQ-GNLVLNLWDCGG---QDTFMENYFTSQRDNIFRNVEVLIYVFDVESRELEKDMHLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKERPLECSCFRTSIWDETLYKAWSSIVYQL.................................................................................................................................................................................................................................................................................................................................................... 241
62 -12.000[J] KOG0459 Polypeptide release factor 3  ali follow..  16  32.................................................................................................................................................VENLDKAPEDLKDEVQESIPVPDEQEASEDHDEVMLHPVHNPAKAKEKAAQEKAAKEEAEDVAEANKKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDRQKGKTVEVGRAHFETESTRFTILDAPG-----------HKSYVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVSKLIVVVNKMDDPSKERYDEIEQKMVPFLKASGYNTFLPISGLMGKNMDQ................................................................................................................................ 298
63 -12.000[J] KOG0469 Elongation factor 2  ali follow..  15  21........................................................................................................................................................................................................................NMSVIAHVDHGKSTLTDSLVSKAGIIAGSKACITIKSTAISLFFELEKINLIDSPG---------------SSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLFMNKMDRALLELQLGAEELFQTFQRIVENINVIIATYGDDDG................................................................................................................................... 209
64 -11.900[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  18  2..................................................................................................................................................................................................................KNQSEINIGLVGHVDHGKTTLTKALSGTKRGISIRLTTAEICERCGTETELLRKVSFVDAPG-----------HETLMATMLSGAALMDGAILVIAANEPCTKEHLMALDVI----KDVIVVQNKIDIVSKERALESYREIKEFVKCAEDAPIIPVSAQQGANIDILIETIEERIKTPKRDVD............................................................................................................... 205
65 -11.700[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  18  10........................................................................................................................................................................................................................KILIIGESGVGKSSLLLRFTDDTDPELAATIGVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSY-----------YRGAQGVILVYDVTRRDTFVKNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSML----FIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVK...................................................................................................... 186
66 -11.600[R] KOG2203 GTP-binding protein  ali follow..  14  38LSYAVVAIMGPQSSGKSTLLNHLFKTSFREMDAFAGTTKGIWMARCVGIEPFTIAMDLEGTDGRERGEDDTTFEKALFAIAVADIVLINMAANKPLLKTVFQVMLRLFSPRKTTLLFVIRDKTKTPIELLERALRE--WDSVRKPEAHKNTPLNEFFNQFEQEVAELRQRFFHSISPGGLAGDRRGVVPASGFSFSSQQIWKVIKENRDLDLPAHKVMVATVRCEEIANEKLRDLATNEGGLVPGFGKKLSSILEKYFSYDAEAIYFDEGVRKEKRLQLKLNALDFVYPSYATMLGRSNALESFKIRLEQSLNQGEGFAKAVRDSQQSCLAAVKQATWDASKIREKLCRDIDAHTFFARSAKLSELTANYEKRLTQALSEPVESLFEAGGKETWPSIRKLLKRETET--------------AVTDFLDVVTGFELDHAKIDAMVQNLKNYSQSLVEKKAREEAAKILIRMKDRFSTVFSHDKDSMPRVWTGKEDIRAITKDARA 580
67 -11.500[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  11  58..................................................................................................................................................................................................................STEVKPRILLMGLRRSGKSSIQKVVFHKETLFLESTNKICREDVSNS---SFVNFQIWDFPGQIDFFDPTFDYEMI--------FRGTGALIFVIDSQDDYMEALARLHLTVTRAYKNFEVFIHKVDGLSDDHKIETQRDIHQRAND-KIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLEN-LLNIFISNS.................................................................................................... 255
68 -11.400[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  14  22....KLVLLGESAVGKSSLVLRFVKGQHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAG--------QERYHSLAPMYYRGAQAAIVVYDITNEESFARAK-VKELQRQASPNIVIALNKADLANKRAVDFQEAQSYADD-METSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSAR...................................................................................................................................................................................................................................................................................................................................... 195
69 -11.300[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  14  446...AVVTIMGHVDHGKTTLLDRF-RESRVTEGEAGGITQHIGAYQIKANGKKITFLDTPG--------HEAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHS-KAAGVPIIVAINKIDKPGANPQPVAWDPENGSEFVEISAKFNQNLDELLDTVLLVAEVQELKADPTVRAI------------------------TVVEARLDQGKGAIATLLVGTLHVQDPIVVGNTYGRVRTMTNDLGRRIKEA--SDVPQAGDHFAVFEDEKAARKADVQGSAE--ALAASLQKIEVEGVKVDIVHSAVGISESDISLA----AASNAIIIGFN-------RPTGLAREQAAQEEVDIRLHSIIY--------IEEVETAMRGMLDPEFKEEIIGEAI--VRETFNVSKVGTIAGFMVKVARDASVRVIREGVVIHDGAIASL----KHFKDDVKEVGNAQEGLMVE..................................... 922
70 -11.300[T] KOG4252 GTP-binding protein  ali follow..  15  11....KMVVVGNGAVGKSSMIQRYCKGITKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAG--------QEEFDAITKAYYRGAQACVLVFSTRGSFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNELAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAED......................................................................................................................................................................................................................................................................................................................................... 180
71 -11.300[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  15  1MQAIKCVVVGDGAVGKTCLL--LSYTTNAFPGEYILTVFDTYSTNVMVDGRPINL-DTAG--------QDDYDQFRHLSFPQTDVFLFALNNPASFENVRAKWYPEVSHHCNTPIILVGTKADLREDRDTIERLREIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKS...................................................................................................................................................................................................................................................................................................................................... 190
72 -11.300[R] COG1162 Predicted GTPases  ali follow..  18  77...........PVVGDFVVLLDQPETGSRMVVNI--LPRRTCL--------------------SRGAAGDGGGEQLIAANLDTIFIVTSVGKDLNLRRLERYLA--IVYSSGASPVILLNKIDLADDPARLVEKIR----PVIPLSALSKTGLDALGPYLNP------------------------------------------------------TVALVGSSGVGKSTLINAFLGETVQKTADIRKTTTVRQMFLLPNGA---VLIDNPGIRE--------------------------IQLGDSAEGLEKAFSEIVDAANEPGCAVLQAVRDGIIPEERLESYHR--LTDELSFQSKKAEIGLKRLEKERYREMAVNIKKYRKFTGK.................................................................................................................. 368
73 -11.100[J] COG0012 Predicted GTPase, probable translation factor  ali follow..  13  2....EIGVVGKPNVGKSTFFSAATLVD-VEIANYPFTTIDANVGVTYAI-IPVKMIDVAGLVPGAHE--RGLGNKFLDDLRMASALIHVVDVTGKWSQEDLLAFASEIRRINKPMIIAANKADAASEEQINRLIKEGE-YIVVPTSAAAELTLRKA-AGFIDYIPGSSEFKILKDMNERQKKALLMIKEKVLDRFGSTGVQEVINKAVFELLNLIPVYPVQDENKLTDQFLPHVFLMKKGSNPRDLAFKVHTDL-------GRGFLYAINAKTKRRIGED------------YELQFNDIIKIVAVTK.................................................................................................................................................................................................... 397
74 -11.100[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  15  11....KLVFLGDQSVGKTSIITRFMYDKDTTYQATIGIDFLSKTMYLEDRTVRLQLWDTAG--------QERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTS-IEEVRNERAGDVIIVLNKTDLVEKRQVSIEEGDSKGRE-IETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDM...................................................................................................................................................................................................................................................................................................................................... 184
75 -10.900[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  18  11........................................................................................................................................................................................................................RLILIGDSTVGKSSLLKFFTDGKAELSDPTVGVDFFARLIEMKDGTQKLQLWDTAGQERFRSI-----------TKSYYRNSVGVLLVYDISNHASFEHMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRS................................................................................................................. 181

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.