current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [J] COG1471 Ribosomal protein S4E, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MAIMASRKHLKRFKSPVHWPIHPKEYKWTVKPSPGPHAIENSLPLMIIVRDILKVADNAREARKIINSGEVLVDGRPRKNYKFPVGFMDVVSIPRTGDVYRVLPDERGRLVLHPIDEENAGFKLCKIVNKTTIKGGRTQLNLHDGRNYLSDDEFRVGDVVKLSIPEQEILERIPFEKDSLGLVTGGRHTGEIGKIKKINITRSSMPNTAVIETGAGKTFLTLKDYVFVIGKDESVISLPGGKLast
1 -110.000[J] COG1471 Ribosomal protein S4E  ali  100  1MAIMASRKHLKRFKSPVHWPIHPKEYKWTVKPSPGPHAIENSLPLMIIVRDILKVADNAREARKIINSGEVLVDGRPRKNYKFPVGFMDVVSIPRTGDVYRVLPDERGRLVLHPIDEENAGFKLCKIVNKTTIKGGRTQLNLHDGRNYLSDDEFRVGDVVKLSIPEQEILERIPFEKDSLGLVTGGRHTGEIGKIKKINITRSSMPNTAVIETGAGKTFLTLKDYVFVIGKDESVISLPGGK 242
2 -95.400[J] KOG0378 40S ribosomal protein S4  ali follow..  38  1MAR-GLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPYLNTYDGRTIYPDPLIKPNDTIKLDLEANKIVEFIKFDVGNVVMVTGGRNRGRVGVIKNREKHKGSFETIH-IQDSTGHEFATRLGNVYTIGKGKPWVSLPKGK 242
3 -10.100[S] COG2501 Uncharacterized conserved protein  ali follow..  22  9.......................................TEMITLGQFLK-LADVIQSGGMAKWFLSEHEVLVNDEPDNRRGRKLYVGDVVEIEGFGSFQVV............................................................................................................................................ 70
4 -9.800[S] KOG4837 Uncharacterized conserved protein  ali follow..  15  81........................................NSLRADLLLKAGLGMARN--KVELNFYESKIRVNGKKLPKKSAQLEVGDEIDVIRGFSQSNPSHLVVARVSILSVSEREEGLSVHLRRYKSLL............................................................................................................. 171
5 -8.550[J] COG0522 Ribosomal protein S4 and related proteins  ali follow..  13  48LSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGR-RMGFGATRAESRQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKKQSRV........................................................................................................................................... 155
6 -8.050[J] KOG3301 Ribosomal protein S4  ali follow..  17  98.........................................ALRIEDFLERRLGLAKSIHHARVLIFQRHIRVGKQIVNVPSFVVRLDTQKHIDFALSS............................................................................................................................................... 162
7 -7.620[A] KOG4655 U3 small nucleolar ribonucleoprotein (snoRNP) component  ali follow..  14  131.............................................HFPLA--VRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLVNLEDFVTWVDGSKIKEHVLRYNDMRDDFQM............................................................................................................................... 200
8 -6.520[S] COG4722 Phage-related protein  ali follow..  11  32...................EIYGRPGAFFFEKRDGPILLP--VEVTLHEKDHQSYRSLVRELAVYLDTEEGILADESVLDEIATVGQGEIQFFCPDPYWYAIEDDVMSWNGPGTYTLDRKGTAVSYPKIEIQGSNVGGSIQLTDNADITFTGELAVGETLVLDSKFVTAYDMPVLVPSANRLSISVEGNATVSTFK.............................................. 240
9 -6.330[J] COG0198 Ribosomal protein L24  ali follow..  23  3.............................................................................................................................................................................KIRRDDEVIVIAGKDKGKRGKVLKVLADDR....................................... 32
10 -6.240[S] COG4332 Uncharacterized protein conserved in bacteria  ali follow..  16  138.....................................EMPTSLRLDRLLASELGISRS--RLQTLAERRLLVVDPDGAKALRKPARQGMTIRID.................................................................................................................................................... 192

FFAS is supported by the NIH grant R01-GM087218-01
1 2 5 3 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.