current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG1996 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .
# Score Template Links and tools%idFirst MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAILast
1 -32.100[K] COG1996 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger)  ali  100  1MVEAIYRCAKCGREVKIDLSVTRDLRCPYCGSKILYKPRPKVPRRVKAI 49
2 -25.900[K] KOG3507 DNA-directed RNA polymerase, subunit RPB7.0  ali follow..  37  15...MIYICGECHTENEI--KSRDPIRCRECGYRIMYKKRTKRLVVFDA. 57
3 -11.900[S] COG2331 Uncharacterized protein conserved in bacteria  ali follow..  22  1MPTYSYECTQCANRFDVVQAFTDALTTCERCSGRLRKLFNAVGVVFKG. 49
4 -10.800[R] COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain  ali follow..  19  3....NKGCIKCGSTFDVQHNRFLVVYCKNCGYSEFYNKESSTAGNI... 61
5 -9.490[S] COG5319 Uncharacterized protein conserved in bacteria  ali follow..  26  1MIHYNLAC-DKGHAFEGRQVARRLVTCPSCGSDSVSKQ........... 46
6 -8.480[R] COG3364 Zn-ribbon containing protein  ali follow..  21  5.ELMPHRCTRCGTIFEDGDSVILS--CPNCGWNKFLYVKKEPEGLENQ. 50
7 -8.220[J] COG2051 Ribosomal protein S27E  ali follow..  26  17...LRVKCPNCGNEQTIFSHATFPVRCLSCGTELVYSMGGKAKIVGEVV 62
8 -8.160[R] KOG2703 C4-type Zn-finger protein  ali follow..  21  279VMTFPSTCGACTEPCETRMFVTKASTCDSCGYR................ 321
9 -8.130[S] COG4640 Predicted membrane protein  ali follow..  25  1...MKS-CPKCGQQAQDDVQ------CTQCGHKFDSRQALYRKST.... 36
10 -8.080[R] COG1326 Uncharacterized archaeal Zn-finger protein  ali follow..  24  2IREIEIECPSCSPQEEVTHEVLKEVRCMECGQVHPAKMKTPKNVRLKVI 55

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.