current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG2229 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MRENKIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLEVLast
1 -85.300[R] COG2229 Predicted GTPase  ali  100  1MRENKIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLEV 178
2 -52.600[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  17  11...FKLLIIGDSGVGKSSLLLRFADNTFSENYI------------TTIGVDFKIRTMGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNVKRWLQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMNISFFETSAKEDKNVEPMFTCITSLVLTAKL. 175
3 -51.600[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  19  9...FKLLLIGDSGVGKSCLLLRFADDSYLDSYI------------STIGVDFKIRTVGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYAENVNKLLVGNKCDLTSQKVVSTETAKAFADELGIPFLETSAKNATNVEEAFMAMTAAIKTRMA. 174
4 -51.500[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  21  10...IKFLALGDSGVGKTSVLYQYTDGKFNSKFI------------TTVGIDFREKRVGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRME. 186
5 -51.200[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  19  10...IKLLLIGDSGVGKSCLLLRFSEDSFTPSFI------------TTIGIDFKIRTIGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHAENVYKILIGNKCDCEDQRQVSFEQGQALADELGVKFLEASAKTNVNVDEAFFTLAREIKKQKI. 175
6 -50.900[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  15  13...FKLVLVGDGGTGKTTFVKRHLTGEFEKKYI------------ATIGVEVHPLSFFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKA--KTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQL 176
7 -50.700[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  18  10...FKIVLIGNAGVGKTCLVRRFTQGLFPPGQG------------ATIGVGFMIKTVGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYANKVITVLVGNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEAR. 175
8 -50.300[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  18  9...FKFLVIGSAGTGKSCLLHQFIENKFKQDSN------------HTIGVEFGSRVVGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLAPNIVVILCGNKKDLDPEREVTFLEASRFAQENELMFLETSALTGENVEEAFLKCARTILNKID. 174
9 -50.200[T] KOG4252 GTP-binding protein  ali follow..  16  10...IKMVVVGNGAVGKSSMIQRYCKGIFTKDYK------------KTIGVDFLERQIDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLRLRFYRTSVKEDLNVNEVFKYLAEKYLQKLK. 174
10 -50.000[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  15  13...FKIVLLGEGCVGKSSLVLRFVENKFSCKHL------------STIQASFQNKTVDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLNTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEHSR. 178
11 -50.000[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  21  23...FKILIIGNSSVGKTSFLFRYADDSFTPAFV------------STVGIDFKVKTIDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMS. 188
12 -49.800[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  18  12...FKYIIIGDMGVGKSCLLHQFTEKKFMADCP------------HTIGVEFGTRIIGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQ. 177
13 -49.800[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  13  21...FKLVLLGESAVGKSSLVLRFVKGQFHEFQE------------STIGAAFLTQTVDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQAPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEP. 186
14 -49.600[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  19  10...YKLVFLGDQSVGKTSIITRFMYDKFDTTYQ------------ATIGIDFLSKTMDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGVMFIETSAKAGFNIKPLFRKIAAALPGMES. 175
15 -49.500[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  18  7...FKYIIIGDTGVGKSCLLLQFTDKRFQPVHD------------LTIGVEFGARMVGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYRKIQ. 172
16 -49.400[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  15  11...FKTVLIGDSGVGKSNLLMRFTRNEFNIESK------------STIGVEFATRNINKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHASNIVIMLVGNKTDLLHLRAVSTEEAQAFAAENNLSFIETSAMDASNVEEAFQTVLTEIFRIVS. 176
17 -48.800[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  16  10...FRLILIGDSTVGKSSLLKFFTDGKFAELSD------------PTVGVDFFARLIGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIHRPVFALVGCKLDLINHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIR. 180
18 -48.200[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  19  9...LKILIIGESGVGKSSLLLRFTDDTFDPELA------------ATIGVDFKVKTIGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCNDIVNMLVGNKIDKEN-REVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPG. 174
19 -47.300[R] KOG0394 Ras-related GTPase  ali follow..  20  9...LKVIILGDSGVGKTSLMNQYVNKKFSNQYK------------ATIGADFLTKEVDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQAENFPFVLIGNKVDVDDGNSSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGE. 181
20 -43.700[R] KOG1673 Ras GTPases  ali follow..  14  101..SLKISLLGDCQTGKTTFVVKYVGDEN-------------QSFLEMTGLNLMDKTFGVTISFSIWDVGGDERSKDHIPIACKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILIGTKFDDPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARL...... 266
21 -41.600[R] KOG0395 Ras-related GTPase  ali follow..  11  18.NSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFH----RKVYNIR------GDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKAELPMVICGNKNDHGELCRQTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHE. 195
22 -40.700[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  22  469...GKVIMLGDSGVGKTSLLIRFRDGRYVPSYFL-----------STVGIDFRNKVVGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAWLGEIREYAEDVVIVLIGNKADCSSERQVKREDGERLGREHNVPFMETSAKTGLNVELSFTAVARQLKSR... 634
23 -35.600[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  18  16.EQYSILILGLDNAGKTTFLETLKK-------EYSLAFKALEKIQPTVGQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVDEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISVLPISALTGEGVKDAIEWMIVRLERNKK. 191
24 -34.700[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  19  19.EEMELTLVGLQFSGKTTFVNVIASGQFAED------------MIPTVGFNMRKITRG-NVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIEICCYSISCKEKDNIDITLQWLIQHSKSQSR. 186
25 -34.600[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  20  16.REMRILILGLDGAGKTTILYRLQVGEVVTT-------------IPTIGFNVEQVTY-KNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMEEELAGAILVVLANKQDMDGCMTVAEVHHALGLENLK--IFKTSATKGEGLDQAMDWLSNTLQSR... 180
26 -34.500[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  17  16.KEMRILMVGLDAAGKTTILYKLKLGEIVTT-------------IPTIGFNVETVEY-KNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLR--IQSTCATSGEGLYEGLDWLSNNIASK... 180
27 -34.400[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  15  16.QEVRILLLGLDNAGKTTLLKQLASEDISHI-------------TPTQGFNIKSVQS-QGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIR--IQSCSALTGEGVQDGMNWVCKNVNAKKK. 182
28 -34.200[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  18  20.KEMRILMLGLDAAGKTTILYKLKLNQSVVT-------------IPTVGFNVETVTY-KNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLK--VQPTCALTGDGLLEGLAWLSQNAKLK... 184
29 -34.200[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  18  17.KELRILILGLDGAGKTTILYRLQIGEVVTT-------------KPTIGFNVETLSY-KNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMEEELQDAALLVFANKQDQPGALSASEVSKELNLVELK--IVASSAIKGEGITEGLDWLIDVIKEE... 181
30 -34.200[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  16  15.RELRLLMLGLDNAGKTTILKKFNGEDIDTI-------------SPTLGFNIKTLEH-RGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLEERLAGATLLIFANKQDLPGALSSNAIREALELDSIR--IQGCSAVTGENLLPGIDWLLDDISSRIF. 181
31 -33.700[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  15  1MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTV-----DTYSTNVMVD------GRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVAKWYPEVSHHCPNTPIILVGTKADLREDRDTHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTG...... 176
32 -32.500[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  19  19.KEAKILFLGLDNAGKTTLLHMLKDERLVQH-------------QPTQHPTSEELSIG-KIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALDEALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTLEVFMCSIVRKMGYGEGFKWLSQYIN..... 193
33 -30.300[T] KOG3886 GTP-binding protein  ali follow..  15  40..KKKVLLMGKSGSGKTSMRSIIFA-NYIARDTRRLGATILDRIHSTFDVEHSHVRFLGNLVLNLWDCGGQDTFTSQRDNIFRNVEVLIYVFDVESRELEKDMHYYLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREESRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQ. 246
34 -28.700[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  18  54.KSNTVLLSGLSGSGKTVLFYQLRDGSSHQG------------AVTSMEPNEGTFVLHKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALERAASEYLYDILTNASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIFSHCHNKVTV 237
35 -25.200[E] COG4917 Ethanolamine utilization protein  ali follow..  19  3....RIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFN----------------------DKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPESRLP-----AGLLDIGVSKRQIAVISKTDMPDA-DVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQE... 149
36 -25.100[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  15  13.KPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLP-------YTNLPSEFF----PDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKWLPLFRQLEVRVPIIVAGYEVDNKEAYNHFSIEQITSALMKQYRSIQWSAQRLDQAKDVLYYAQKAV...... 177
37 -23.900[S] KOG4273 Uncharacterized conserved protein  ali follow..  10  6....GVLVVGSSGVGKRTLLSRLLSVEFEDS------------SESSSQTEVHGWTINTKADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQDWVSHTDINSFDILLCIG-NKVDRVPHHLAHDPSRDLYSDIDDFGISETEGSSLLGSEDASLDIRGACLE.... 176
38 -23.300[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  14  61.VKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFL---------ESTNKICREDVSNSSFVNFQIWDFPGQIDFFFDYEMIFRGTGALIFVIDSQDDEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRAND--SFYLTSIYDHSIFEAFSKVVQKLIPQLPT 243
39 -20.500[R] COG1084 Predicted GTPase  ali follow..  14  164....TVVIAGFPNVGKSTLLRTLTGAEPEVADYP-----------TTKGIQIGHLERK-WKRIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCGYTLESQYLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVE-----DPLKVSAFEGRGVSKIIKKLEGLYEKE... 328
40 -20.300[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  13  171.....VLICGYPNVGKSSFMNKVTRADV----------DVQPYAFTTKSLFVGHTDY-KYLRYQVIDTPG-EMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEESEEQVLLKMSTLTDEGVMSVKNAACERLLDQ... 352
41 -19.800[R] COG3596 Predicted GTPase  ali follow..  13  37.YEPVIGIMGKTGAGKSSLCNALFAGEV---------SPVSDVAACTRDPLRFRLQIG-EHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATD-EHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISHPVCAVSVRLQWGLRVMAERMIKCLPRE... 219
42 -19.100[R] KOG2486 Predicted GTPase  ali follow..  14  137....EFALVGRSNVGKSSLLNSLVRRKRL--------ALTSKKPGKTQCINHFRI----NDKWYLVDLPGKQDWNKFTKDYFSTLVSVFLLVDASIPVKPIDYASWLGQ-----NQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQ-PWIMTSSVTNQGRDEILLHMAQLRNYWLK. 317
43 -18.600[R] COG0218 Predicted GTPase  ali follow..  17  27....EIALAGRSNVGKSSFINTMLNRKNL--------ARTSGKPGKTQLLNFFNI----DDKMRFVDVPGREKWGCMIEEYLENLRAVVSLVDLRHDPSADDVQEFLKYY-----EIPVIIVATKADKIPRGKWNKHESAIKKKDPSDDFILFSSVSKAGMDEAWDAILEKL...... 195
44 -16.700[M] COG0481 Membrane GTPase LepA  ali follow..  14  1MKNIRFSIIAHIDHGKSTLSDRLIQTC--MEAQVLDSMDLERERGITIKAQSVTLNYGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEM---NLEVVPILNKIDLPAADPERVAEEIEDIVGDAMEAVRCSAKTGVGIEDVLEEIVHKI...... 180
45 -16.300[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  14  40.ATINIGTIGHVAHGKSTVVKAI-------SGVHTVRFKNELERNITIKLGYANAKIRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHL-AAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAF-EGAPIIPISAQLKYNIEVVCEYIVKKIP..... 244
46 -16.300[P] COG0370 Fe2+ transport system protein B  ali follow..  19  1MSQNTYCILGNPNTGKTSLFNALT----------GSYEYVGNWSGVTVEKKVGTL---RSKTGKLIDLPGRDETVVTRFLLEEKFDCMLNIVDSSQIERNLNLTVQLLEY-----GAPVVMGLNMIDVAAGRGIHLNIQNL-AKKLRIPILPVVARSGKGTEDILSTLSEKHVAP... 164
47 -16.000[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  19  1MKNQSEINIGLVG-GKTTLTKAL-------SGVWTDTHSEETKRGISIRLGYADITFRKCPKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMAL-DVIGVKDVIVVQNKIDIVSKERALESYREIKEF-EDAPIIPVSAQQGANIDILIETIEERIK..... 198
48 -15.700[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  16  44....NFGIVAHVDHGKSTLADRLLEMC--GQKQMLDKLQVERERGITVKAQTAALRH-RGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEK---NIQIIPVINKIDLPGADIKSVETQLKNLFENPEECLHISAKSGLNVDKVLEAIIDRV...... 211
49 -15.600[DZ] COG5019 Septin family protein  ali follow..  15  95..NFNVLVLGESGSGKSTLVNTLLNRDVYPPTQKSLTGDFGVNPEPTVMINSSAVEIVENLQLNVIDTPGEGRYDQYRSTIQDPRVHACIFFIQPTGHAISAME--LRVMLALHEKVNIIPIIAKADTLTDDELNFTKEMILRQYHNIRIFFPPTYETDD.................. 281
50 -15.600[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  183.....VTIMGHVDHGKTTLLDKFRKTQVAAVETGGI----------TQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVDGVMKQTVESIQH------AKDAQVPIILAVNKCDKAEA-DPEKVKKELLAYDVDVQAVPVSALTGDNLMALAEATVALAE..... 343
51 -15.400[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  19  1......MIIVTSG-GKTALLKAL-------TGTSTAHLPEEKKRGMTIDLGYAYLPLENK-VLGFIDVPGHEKF----SNMLAGLGGVAMLIVAADEGVAVQTKEHLA-ILRQLQFHEIIVVITKADRTNSAQIESLIQTIKQDYSNANYFVTSAETGQGISELRHYLANLAELA... 165
52 -15.200[J] COG4108 Peptide chain release factor RF-3  ali follow..  13  17....TFAIISHPDAGKTTIIQVAGTVKGRGSNQHAKSDWMEMEKERGISVTTSVMQFPGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLM----VTRLRDTPIVTFMNKLDREIRDPMELMDEVENELKIACSPITWPIGCGKEFKGVYHIHRDET...... 192
53 -15.000[F] COG1618 Predicted nucleotide kinase  ali follow..  13  12....RIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELIS-QSFVSAVEEVLESDKPVLAVLHH--------SSRHPLAQRFRKGFEVLTVDKGNRDELPEKITNRFLRK...... 182
54 -14.900[J] KOG0468 U5 snRNP-specific protein  ali follow..  19  133....NVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLLFTEQERGCSIKATPVTLQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQE---RQAITVCINKID................................................... 263
55 -14.800[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  19  95.....ILLVGQYSTGKTTFIRYLLESDFPGIRIGPEGDEEGSIPGNALVVDFGNAFLNR--SVTIVDTPGIDRFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVL--NKSDMVDHQQLMRVYGAL..................................... 270
56 -14.800[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  15  3.RPLIIGVGGPVGAGKTMLIERLTRMAAITNDIYTKEDARILLNTSVLPAD-EMCDKHPDLQLLFLESGGDNLSATFSPDLVD----SIYIIDVAQGEKIPRKGGQGMIKSD-------LFIINKVDLAPGANVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQ..... 200
57 -14.600[J] KOG0465 Mitochondrial elongation factor  ali follow..  17  72....NIGISAHIDSGKTTFTERV----LYYTKRIKAIHEVRGRDNVGAKMDSMDLEREKGIHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRR----NVPRVTFINKMDRMGSDPFRAIEQLNSKLKIPAAAVQIPIGSESSLSGVVDLINRVA...... 250
58 -14.600[R] COG1159 GTPase  ali follow..  16  11.....IAIVGRPNVGKSTLLNKLLGQKI----------SITSRKAQTTRHRIVGIHTEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTRWTPDDE--MVLNKLRDG--KAPVILAVNKVDVQEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEA... 176
59 -14.400[R] COG1163 Predicted GTPase  ali follow..  15  67....SVGFVGFPSVGKSTLLSKLTG----------TESEAAEYEFTTLVTVPGVIRY-KGAKIQMLDLPG-RGRGKQVIAVARTCNLLFIILDVNKPHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLE. 236
60 -14.300[J] KOG0469 Elongation factor 2  ali follow..  16  21....NMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFKDEQERCITIKSTAISLYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAE---RIKPVLFMNKMD................................................... 173
61 -14.100[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  22  335..ELKSILIGLPNAGKSTILNKISNAKP----------KIGHWQFTTLSPTIGTVSLGFQDVFTVADIPG---LEFLRHI--ERSNGWVFVLDLSNKNPLNDLQLLIEEVGTLVKTKNILIVCNKVDIDAEKSESFAKYLQVEKSQEWDCVPISALREKT.................. 499
62 -13.800[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  15  35..EFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGDEQYERFRRNIVDNRIHCCFYFISPFGHGLKPLD--VEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQE.................................. 200
63 -13.600[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  17  66....RIGFVGFPSVGKSTLLSNLAG----------VYSEVAAYEFTTLTTVPGVIRY-KGAKIQLLDLPG---------AVARTCNLILIVLDVLKPGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVE. 235
64 -13.500[K] KOG1534 Putative transcription factor FET5  ali follow..  16  1MVKVAAFVCGVASSGKSTFCGALMSRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWDEDYLIFDMPGQELYPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSEVPHINLLSKMDLLKDHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYI.......... 249
65 -13.500[R] KOG0410 Predicted GTP binding protein  ali follow..  14  311....VVSLVGYTNAGKSTLLNQLTGANVLAEN----------RLFATLDPTTRRVQMQNGKEFLLTDTVG-AAFRATLEEIAE-SSLLVHVVDISHPLAEQQIEAVEKVMSELVSSIPKLVVWNKVDRVDDPQKVKLEAEETGDT-----ICISALTGEGLDDFCNAVHEKLKDSMV. 477
66 -13.500[R] KOG1533 Predicted GTPase  ali follow..  14  31WTMYGVLVIGAPGAGKSTFCAGLTDTEMITVNDVMDRLGLGPNGALKYCIETLGANCNWHKKYLIIDCPGQELYWKVIRFLEK-RLCALHLADSLYSDPSKFISVALSTLATMVTEMPQVNCLSKADLFSEDGTYDLEFFSHLPDVNRLLDLLNEVPGLEKYRKLNEAICGVISDFDL 256
67 -13.400[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  13  74.RHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFTDGDKAYLMTEGSDEKKSVKTVLVLVDSPGTTELDSWIDKFCLDADVFVLVANSESTLMNTEKH-FFHKVNEWLSKPNIFILNNRWDASASEPEYMEDVRRQHMERCLHIFFVSAKEVLSARK............... 293
68 -13.400[R] COG0536 Predicted GTPase  ali follow..  19  155..ELKSMLVGFPSAGKSSLISVMSAAKP----------KIGDYPFTTLQPNLGVVNVGHE-TFTMADVPG----------LIPGAS-LVHVVDTATMDPGRDPISDIEALEAELAQRPRLVVLNKADVPEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQD.... 342
69 -13.300[R] COG1160 Predicted GTPases  ali follow..  16  1MATPVVALVGRPNVGKSTLFNRLTRTR---------DALVADFPGLTRDRKYGHAHIA-GYDFIVIDTGGEEKMAEQSLLAIDEADIVLFLVDAR--AGLTAADIGIANYLRQRQNKITVVVANKTDGIDADSHCAEFYQL-------EIEQIAASQGRGVTQLMEQVLAPFAE.... 166
70 -13.100[R] COG5258 GTPase  ali follow..  19  105PPTVTVVALGNVDAGKSTLVGVLTDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSGDKVVLLVDVGGHERY----RTALRGLFSYVMLVVAANSGVQKMTKEHLGIAVAI--GIPVFVVVTRIDITPSEVFQKTVEEVVRAGRVAPVFYVSSVTGHGLDLLLRFL.......... 324
71 -13.100[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  16  2IENLRIAIIAHVDHGKTTLVDKLLDRKEAESERVMDSNDQEKERGITILAKNTAIK--NGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKA---GLRPIVVVNKIDRPGARPDWVIDQ....................................... 143
72 -12.900[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  20  26.SLLRFLTCGSVDDGKSTLIGRLDQLSSLHNDSKRHGTQLQAEREQGITIDVAYRYFSEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSF--ISTLLGIKHLVVAINKMDLVSEETFTRIREDYLT-NLDIRFVPLSALEGDNVAS............... 215
73 -12.900[R] COG2262 GTPases  ali follow..  14  199....TVSLVGYTNAGKSTLFNRITEARVYAAD----------QLFATLDPTLRRIDVADVGETVLADTVG-AAFKATLQETRQ-ATLLLHVIDAADVRVQENIEAVNTVLEEIAHEIPTLLVMNKIDMLEDFEPRIDRDEENKPIR----VWLSAQTGAGIPQLFQALTERLSGEVA. 366
74 -12.800[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  16  64....RVALIGFPSVGKSTLLTMLTG----------THSEAASYEFTTLTCIPGVIHY-NDTKIQLLDLPG---------AVAKSSDLVLMVLDASKSEGRQILTKELEAVGLRLNKTPPQIYFKKKKTGGISFNTTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIE. 233
75 -12.800[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  14  52.PHVNIGTIGHVDHGKTTLTAAITDLGQASFMDYSQIDKAPEEKARGITISSAHVEYEANRHYAHVDCPGHADY----KNMITGAATMAIIVVSATDGQMPQTREHL-LLARQVGVKQIVVYINKVDMVEPDMIELVEMEMREDGDNTPIVSGSALCALEGRESITKLMEAVDSYITL 244

FFAS is supported by the NIH grant R01-GM087218-01
1 2 8 9 7 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Database searching by flexible protein structure alignment. Protein Sci. 2004 Jul;13(7):1841-50.