current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [G] COG2706 3-carboxymuconate cyclase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQVQPMVVSPDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAGNVSVTRLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQDRICLFTLSDDGHLVAQEPAEVNTVEGAGPRHMVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTLDMMPADFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSVEGFQPTEAQPRGFNIDNSGKYLIAAGQKSHHIAVYEITGTQGLLTEKGRYAVGQGPMWVVVNAYLast
1 -92.200[G] COG2706 3-carboxymuconate cyclase  ali  100  1MKQTVYTASPESQQIHVWSLNHEGTLTLVQVVDVPGQVQPMVVSPDKRYLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAGNVSVTRLQDGLPVELVDVVEGLDGCHSANITPDNRTLWVPALKQDRICLFTLSDDGHLVAQEPAEVNTVEGAGPRHMVFHPNRQYAYCVNELNSSVDVWQLKNPHGEIECVQTLDMMPADFSDTRWAADIHITPDGRHLYACDRTASLITVFSVSEDGSVLSVEGFQPTEAQPRGFNIDNSGKYLIAAGQKSHHIAVYEITGTQGLLTEKGRYAVGQGPMWVVVNAY 331
2 -31.800[S] COG3391 Uncharacterized conserved protein  ali follow..  11  5.QRKRYFLLSLLVAVAVVVSSVQIVTAQLATSRVGDLPEGGALLPTGQVITPAAAPGSTFDRLATG------LRSDNNADAAEAVTTALSPDGKTLLVLTSGYNLNFRNQNTSSGKLVKRQQINIPNTYNGLAWAKDGSRFYVSGGIDDRVYVYAANGNQYILLKNTPANRVTTGAVVAGLAVSPDGSTLVAANFENDSISLFVSSQRDDEVVAVDVASRVITRIPVGSQPNKILLSADQNKLYVANGNSDTISVIDTNSNRVIGTISNDKYVGSSPNSLALSPDERTLYVTLAGENAVAV--VDLRSGRV--SGRIPTGWYPNSVSVSQ. 426
3 -27.200[C] COG4263 Nitrous oxide reductase  ali follow..  10  67.EYYGFWSGGHSGEVRVLGVPSMRELMRIPVFNHHPHISMTDGKYDGKYLFINDKANSRVAR--IRLDVMKCDRIVTIPNVQAIHGLRLQKVPHTRYVFCNAEFIITLYNAIDAETMEVAWQVIVDGNLDNTDMDYSGRFAASTCYNSEKAVDLGGMMRNERD-------WVVVFDIPRIEAEIKAKRFVTLGDSKVPVVDGRRKDGKDSPVTRYIPVPKNPHG---------LNTSPDGKYFIANGKLSPTCTMIAIERLGDLFVVVGEPELGLGPLHTTFDGRGN-AYTTLFIDSQLVKWNLAD......................... 406
4 -21.000[S] COG3490 Uncharacterized protein conserved in bacteria  ali follow..  10  40.AVFASAFRARDGSYGIATVSERGEI--IDRVALPARAHGMATSHATGRTVAFARRPGTFFMA-FDPVQRQE--PVVMHAPENRHHGQFSPDGAILYASENNRGVIGLYDA-RNGFARIGEYDAHGVGTHDMTVSDDGRLIVIANGGIETHSLVLLDAATGQLIQKHVMPEQLRQLSTRHVDLGDNGRIWFACQYEGPRNNLPPLVGHFSKGEDVAFVDLPEETTVRANYVGAIAVNRREGLVGLTSPSGNAAVTLDAKTGSVVSEVT------REAAGVATAAGGIAVSSY---DGFFEAIRSDVASG...................... 364
5 -20.400[T] KOG4378 Nuclear protein COP1  ali follow..  12.....LLAASGGDTVKLFDVSADSGDPCVLSYTPSPGCNSVKWNHTNLVV-ASTGEDKKISLWRKNGQSLGTVPVTGKDGGDSAEEISFSKKGSRYICSGGTGQIVKIWDLQRKLCIKKLKGHTST--ITGVMYNCKDEHLASVSVG-GDLIVHNLASGARATELKDPNGQVVQFVHVRLLDYSRSSRHLLVTAGDDGTVHLWDTTGRSPKMSWLK---------QHSAPTAGVCFSPSNEKIIASVGMDKKLYTYDSGSRRSSSCIAYEAPF----SSLAFGDNGYILVAGTS-NGRVVFYDIRGKPQPVTVLHAFSNSEDVTSLSWQT. 325
6 -18.500[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  11  130......................................KGCYWSPDGTCLLVPVH-LDGMHVIEMPSDLTKLQSEVHVPEGGTVYDCVWYPHMNSLWLATRQHEPIHMWDAFDGCSYSGYDAVDEVMAAISLAFSHDGEQIYAGY--KRCIKIFDTSRPGRFCDDYPVKFAISC------IAQTTAHPHTLTCGNWHGYIQHFDLRCS-------HKQGPLFTLGGHKGGITQLRYGEFGNHLFSGARKCDKILQWDMRNYKQPLVELQRHVDTNQRIQFDLASDSNWLASGDT-RGFVNVWDLKKYG....................... 406
7 -18.200[V] COG4257 Streptogramin lyase  ali follow..  11  70....VWYTAQAQGAAG--RLDPRSGKADRVPLGAGSAPHGVIIGPDQA-AWITDGGQNAIVRVDPKTLAVTRFPLPKDRPNANLNTAVFDKRGHLWFTGQSGI----YGELDPARASLRVFDAPRGPGPYGICVTPDGS-LYFASLAGSYLGRID-PASGAAQVIEPP----TPHQGARRVWSDPQGR-VWISEWNAGQVGMF--DPATHQWREWRLPGSNPH-------AYAIFVDDRGI-VWLSEWSANALVRFDPRTEQ---FDVLPLPRPHANVRQMMGRPGE-VWLSESGTDHLLRY--RSRAANAG................... 347
8 -17.900[R] KOG2055 WD40 repeat protein  ali follow..  10  231....LLLTCGFDRTLRIYQLDGKVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRK---YMYIWDLESAQVQKVGQENFQPSMERFHVDPTGKYIALEGR-SGHINLLHALTG---QFATSFKIEGVLSDVLFTSDGSEMLVLSYG-AEVWHFNVEQRSVV-----RRWQVQDGVSTTHFCLDPSNKYLAIGSK-SGIVNIYDLQTADAAPKPVTTLDNITFSIN------SMSFSQDSQVLAIASRGKKTLRLVHVPSFSVFRNWPTSATPLGRVTCLAFGKGGE--LCVGNEAGRVGLWKLAGKFGYVLLGIQILILHVDVVI..... 555
9 -17.700[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  13  322....VLVVAFSSGAFYLYELPDVNMIHSLS--ISDYPISAALFNCTGDWVALASREIGQLLVWEWQSEQYIMKQQGHS---SEMTCIAYSSDGQFIATGGE-DSKVKLWNTQSSFCFVTFSEHTSG--VTGIQFSRNKKFLVSSSLD-GTVRAFDVNRYRNFR-----TFTSPNPAQFSCVAVDYSGELVVAGGQDVFDIFLWSVKTGSGHEGPVVSIAFSPVATSSTLVSGSVTFSPSGEEIAVATL-SGNITIFDIKSAGQVTTIEGRNAQANYFSTIEYSADGECILAAGK-SANICIYHVREAI....................... 660
10 -17.200[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  13  8....ILATGGYDHTIKVWQA-HTGNCIKTMRFVETSQVNALDRTPDKTRLAAC--GYQCIRLYDLESNCTA-PVINFDGVQKNVTRLGFQEDGNWMFTAGE-DHHVRIWDM-IAAPPHCSRIFDCEAPVNAACLHPNQVEIAMGSQN-GSVFLWDVKSERHERIVPEVDASI------QDVAISPDGRYLAAANN-KGNCYIWSLTSQDQKMSTLRPNRKIPAH---SRYILRCKFSPDSRLL-LTTSGDGTVCIWKTDDFSKWRELCIE---NYWVWDAAFSADSKWLFTASS-DGIARLWKLQTKS....................... 289
11 -17.200[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  18  10....................................SSLLCKFSPDGKYLASCVQYRLVV-------DVNTLQILQLYTCLDQIQHIEWSADSLFILCAMYKRGLVQVWSLEQPEWHCKID--EGSAGLVASCWSPDGRHILNTTEFHLRITVWSLCTKSVSYIKYPK-------ACLQGITFTRDGRYMALAERRDCKDYVSIFVCSDWQLLRHFDTDT--------QDLTGIEWAPNGCVLAVWD-TCLEYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSY-DGKVRILNHVT......................... 254
12 -17.000[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  14  498.....HVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIKLLPDGCTLIVGGE-ASTLSIWDLAAPTPRIKAE--TSSAPACYALAISPDSKVCFSCC-SDGNIAVWDLHNQTLVRQFQGHTDG--ASCIDISNDGTKLWTGG-LDNTVRSWDLREGRQLQQHDFTSQIFS-------LGYCPTGEWLAVGME-SSNVEVL--HVNKPDKYQLH---------LHESCVLSLKFAYCGKWFVSTGK-DNLLNAWRTPYGASIFQSKESSSV----LSCDISVDDKYIVTGSG-DKKATVYEV........................... 768
13 -16.800[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  11  96.....DSDFDETEAISIIKLIPAACEAKIS--HGTQAISALRVEPPGVRF-ASGGLDYYVKLFDFQKMDMSMRYDKELLPAES-NSLAFSPNGETLVVAS-GEAIIRLLDRAGKQWSETVRTKGHTATVNCVEFNPLNKNEFISCSDDGSLRLWNLDDHKVITKCINKHRKVGKRVSPQVCTFSPDGKWIAAGCD-DGSVQAWKYGSQ-------YVNVNYLVRKAHNGSITSIAFSPDSKRL-LSRGFDDTLKMWSLDNPKEPLLVKTGLENAFKSTDCGFSPRAEVVFTGTSTPGTLQFF--DPMTFDLVYK................. 413
14 -16.800[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  477....VLITASEDHTLKMWNLQKTAPAKKSTSLDVKGPVLCVVMSSNGEQCYSGGT-DGLIQGWNTTNPNIDPYDSYDPSVTDAVWGLAYSAAHQRLLSCSA-DGTLRLWNTTEVAPALSVDIKELGIPASVDLVSSDPSHMVASF-SKGYTSIFNMETQQRILTLESNVDTTANSSCQNRVISHPTLSISITAHE-DRHIKFYDNNTGKLIHSMVAHLEAV----------TSLAVDPNGLYL-MSGSHDCSIRLWNLESKTCIQEFTAHRKKEESIHDVAFHPSKCYIASAGADA-LAKVF............................. 779
15 -16.600[S] KOG1407 WD40 repeat protein  ali follow..  10  35.....LASGSVDQTARIWNIEPHGHSKAKDLELKGDSVDQLCWDPKHSDLVATASGDKSVRLWDARSG----KCTQQVELSGENINITYKPDGTHVAVGNR-DDELTILDVRKF---KPLHRRKFNYEVNEIAWNMPGDFFFLTT-GLGTVEVLSYPSLKPLDTLTAHTAGCYC------IAIDPKGRYF-AVGSADSLVSLWDISDMLCLRTFTKLEWPV----------RTISFNYSGEYI-ASASEDLFIDIANVQTGRTVHQIPCRAAM----NSVEWNPKYNLLAYAGDDEGVFRIFGFESS........................ 315
16 -16.500[S] COG3204 Uncharacterized protein conserved in bacteria  ali follow..  71....................................................KSNHAASFQNYHATIDGKEIAGITNNISS-----LTWSAQSNTLFSTINKPAAI--VEMTTNGDFIRTIPLDFVKDLETIEYIGDNQF-VISDERDYAIYVISLTPNSEVKILKKIKIPLPTNCGFEGLAYSRQDHTFWFFKE-KNPIEVYKVNGLLSSNELHISKDEALQRQFTLDDVSGAEFNQQKNTLLVLSHESRAL--QEVTLVGEVIGEMSLTKG-KQAEGVAMDASGNIYIV--SEPNRFYRFTPQSS........................ 322
17 -16.500[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  11  418....VILIGTTRNFVLQGTLSGDFTPITQGHT---DELWGLAIHASKPQFLTCGH-DKHATLWDAVGH----RPVWDKIIEDPAQSSGFHPSGSVVAVGT-LTGRWFVFDTETKDLVTVHTDGNEQ--LSVMRYSPDGNFLAIGS-HDNCIYIYGVSDNG--RKYTRVGKCSGHSSFITHLDWSVNSQFLVSNSG-DYEILYWVPSACKQVVSVETHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDD-FGKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLISTGGKDTSIMQWRV........................... 716
18 -16.200[S] KOG4328 WD40 protein  ali follow..  12  227.NVKMVAAGDKLGNVGFWNLDCGNEEDNDGIYL-SAPVSSIVFQQNSLSRVISSSYDGLIRLMDVEKSVFDLVYSTDEAIFS----LSQRPNDEQSLYFGQDYGVFNVWDLRAGKSVFHWELHER--RINSIDFNPQNPHVMATSSTDGTACLWDLRSMGAKKPKTLSTVNHSRAV--HSAYFSPSGLSL-ATTSLDNYIGVLSGANF-------ENTCMIYHNNTSRWISKKAVWGWDDSYIYVGNL-SKKIDVINPKLKRTVMELHNPLQRA-IPCRIHCHPYNVGTLAGSTAGGQVYVWTTK.......................... 516
19 -16.200[O] KOG3567 Peptidylglycine alpha-amidating monooxygenase  ali follow..  14  444......LGPIEEDTILVID-PNNAAVLQSSGKNLFYLPHGLSIDKDGN-YWVTDVALHQVFKLDPNNKEGPVLILGRSMQPGSPTDVAVDPGTGAIYVSDGYCNS-RIVQFSPSGKFGSSPLPGQFTVPHSLALVPLLGQLCVADRENGRIQCFKTDTKEFVREIKHSSFGRNVFA-IPGLLFAVNGK-PHFGDQEPVQGFVM--NFSNGEI-----IDIFKPVRKHFDMPHDIVASEDGT-VYIGDAHTNTVWKFTLTEKLEHRSVKKAGIEVQEAEAVVETKMEN-----KPTSSELQKMQ---EKQKL.................... 749
20 -16.200[I] COG4247 3-phytase (myo-inositol-hexaphosphate 3-phosphohydrolase)  ali follow..  385...........................................TTPAKSAIIATDKKGGMLVYDLSGKQLQYLPDGKMNNVDLRDGFKLGKAVTLIAASDRTHKAIALYTIDPETRLGVQASGLSDPYGLCMHRDRKGDMSVFVSDPDGLVRQYSLTATANGKVRAKAVRDLKFDTQTEGCVADDETGALYIAEE-DVALWKLGADARSGPARKAIARVADNPALKDDLEGVGLYIQPKGKYLILSSQGNNTYAVFRREGDNAYV------------GSFAVTANGDTDVDGISETDGLDVSSAS-EMGAF.................... 651
21 -16.200[T] COG5170 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  11  1......MDDIEDSLDQWKFAQCFGDKGDVEDITEADIISAVEFDHTGDYL-ATGDKGGRVVLFERNHSEPEFDYLKSLEIEEKINKIRWCKRTN-HFLLSTNDKTIKLWKLYEKNLKVVAENNLSDSHINSISVNSDAETYISAD--DLRINLWNLSISDHSFNIVDIKPENMEEL--TSAEFHPINCNHLMYSSSKGNIKLLDLRQSA-LFEDQEDQDSKSFFSEIISSISDVKFSQNGRYILSRD--YLTLKIWDVNMEKAPVKTIPLHDVLRS-FECTFSGDDKHVLSGSY-SNNFGIYPTDSSL....................... 374
22 -16.200[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  11  78.KLATVLSGACDGEVRIWNLTQRNCIRTIQ--AHEGFVRGICTRFCGTSFFTVGD-DKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFAT-CGQQVDIWDEQRTNPICSMTWGFDS--ISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLK-------KVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHM---------DHVSAVLDVDYSPTGKEFVSASF-DKSIRIFPVDKSRSREVYHTKRMQH---ICVKWTSDSKYIMCGSDEM-NIRLWKANASE....................... 358
23 -16.100[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  13  130.....................................PFCLGFANNESLLAVCTE-TGALELFDSRFYDRQNEENQPSARNNAIFSVNFSKDDSLLATSS-GDQTSKVFDLSTQQCITRLGRRGVSHSVKQVNFCNDSPYNLVSCSRDGSIIFWDMRTHGIVLRIRKAHENSGRDCSITSATWLPQSTSQVISSSANSALKLWDLRTVHTVRPLPAATTPELTTSKRDFGVTNVCTSPDGERIYAASR-DSIIYEYSSRHLNSGFCKTYKDPRLRISSKLACSPDGATLACGGDKTSGVVVFDTTRNCSSSAML................. 432
24 -16.000[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  10  27......................................NAIDFAPNGEHLISCSE-DDQIVIYDCEKGTQSRTVNSKK---YGVDLIHFTHANNTAIHSSTKDDTIRYLSLHDNKYLRYFPGHTK--KVISLCISPVEDTFLSGSLD-KTLRLWDLRSPNCQGLMHLSGRPI--------AAYDPEGL-IFAAGVNSESIKLY--DLRSFDKGPFVTFKLNQEK---ECDWTGLKFSRDGKTILISTNG-SVIRLVDAFHGTPLQTFTGYPNNKGIPIEASFSPDSQFIFSGST-DGRVHIW--NADTGNKVSVLNGDHPGPVQCVQFNP. 294
25 -16.000[R] KOG1273 WD40 repeat protein  ali follow..  37....LLAAGCADGGCVIWDFETRGIAKEIRDNDCSAAITSVSWSKYGHRLLVSAA-DKSLTLW--DVSTGEKIARTILQQTPLQARLNPGLSSPSLCLACPLSSAPMIVDFDIDCTTSKCPESNPPFSPAAACFNKCGDLVYIGN-SKGEILIVDYKSVRVL-----ALVSASGAAPVKNIVFSRNGQYL-LTNSHDRTIRIYENLLPAKNKMKTVGSKCLTQDSVTKMHWKAPCFSGDGEWVVGGSACKGEHKIYIWDRAGHLVKILEGPKEA---IDLAWHPVHPIIVSVSL-AGLVYIWAKDYTE....................... 350
26 -15.900[U] KOG0277 Peroxisomal targeting signal type 2 receptor  ali follow..  11  44..........GCGTLLILDPDEAGL-RLFRSFDWNDGLFDVTWSENNEHVLITCSGDGSLQLWDTAKAAGPLQVYKEHA--QEVYSVDWSQTRG-LVVSGSWDQTVKLWDPTVGKSLCTFRGHESI--IYSTIWSPHIPGCFASASGDQTLRIWDVKAAGVRIVIPAHQAEILS------CDWCKYNENLLVTGAVDCSLRGWDLRNVRQPVFELL---------GHTYAIRRVKFSPFHASVLASCSYDFTVRFWNFSKPDSLLETVEHHT--EFTCGLDFSLQSPTQVADCSWDETIKIYDPACLT....................... 320
27 -15.900[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  3.PEMEIIEATNEELLLGFKLIKSPTDGFTDSVKSSYARSITSLAVQWPWV-ASGGTDGRIFVYDMRTRKQSQIILSH---AGRVNTLKFTPDLSLLLSGSD-DGHMIATRVGSWTKEYDWQKAHAGQAVTHVSCHPSSKLALSLG-GDQVLNTWNL-VNGCVAHKTNLKNKATLDFQTGCLSWSKQGDHFTLSGP--LVLEIWGIENAH-----------VMRRIEMPSKPICITWLDGNECLTGLD--NGNIAWISLKDEDDTPP---TFILAHEVRVKAIAYLNEFLATVSI-AGQIKVWKIDMETRKLEEIARSFMDCRPTDLGLLD. 314
28 -15.700[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  11  300..........WSKRLHLGPRASLPSVCMYTFHHTNNNMNCAEFSPDSTMI-ACGFQESYIRLWSIKADKKSLPKSTSVEDSGPVYGTTFSPDNKYLLSCSE-DASARLWSVDTKTALVAYKGHTGP--VWDVAFGPFGHYFATAS-HDQTAQLWSCDHIYPLRVFAGHLSDVDC------VTFHPNSAYVLTGSS-DKTCRLWDVHRGHSVRVFNGHTQPV----------TAVAIAPDGHTM-ASADSEGLIHLWDIGTGRRIKTMRGHRGN----YSLSFSRESTVLVSGGS-DCTVRAWDVFKTN....................... 580
29 -15.700[R] KOG2096 WD40 repeat protein  ali follow..  13  126.WEFTLQAHFHDLTVFFVCFLKFRFLRIN--LPAGGHPTAVAFADDASSIVVACHHMSGSSLYMYGEDKQKDHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLGHVDTNQL--KNHMAAVSPNGRFLAAAAFTAD-VKVWEIVYQKDGSVKEVSRVMQLKGSAVTWLCFSPNSEQIITASK-DGSIRVWNINVRYHLDEDPKTLKVFPIPLCDPLHYDRLSLCPEGKILAAS--HGSTLQWLCAETGNVLDTAEKAHEGD---TCISWAPKAI-VLGTSGDDKKVKLWEAPKSQ....................... 452
30 -15.600[S] KOG0282 mRNA splicing factor  ali follow..  303....LLLSCSMDCKIKLWEVYGERRCLR-TFIGHSKAVRDICFNTAGTQFLSAAY-DRYLKLW--DTETGQC--ISRFTNRKVPYCVKFNPDED-LFVAGMSDKKIVQWDIRSGEIVQEYDRHLGA--VNTIVFVDENRRFVSTS-DDKSLRVWEWDIPVDFKYIAEPSMHSMPA-----VTLSPNGKWL-ACQSMDNQILIFGAQNRFRLNKKKIF-----KGHMVAGYACQVDFSPDMSYV-ISGDGNGKLNIWDWKTTKLYSRFKAHDKV----IGAVWHPHETSKVITCGWDGLIKLWD............................ 579
31 -15.500[T] KOG1354 Serine/threonine protein phosphatase 2A, regulatory subunit  ali follow..  1......MAGAGGGNDIQWCFSQVKG-AVDDDVAEADIISTVEFNHSGELL-ATGDKGGRVVIFQQEQEN-KIQSHSRGEYNVYSTFQSHEPEFDYLKSLEI-EEKINKIRWLPQKNAAQFLLSTNDKHINSISINSDYETYLSAD--DLRINLWHLEITDRSFNIVDIKPANMEELTETAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSSSISDVKFSHSGRYMMTRD--YLSVKIWDLNMENRPVETYQVHEYLRSKFECCWNGSDSVVMTGSY-NNFFRMFDRNTKRDITLEASR............... 383
32 -15.400[U] COG0823 Periplasmic component of the Tol biopolymer transport system  ali follow..  12  185.TRIAYVVVNDKDQLRIADYDGYNERLVLRSKQPLMSP---AWSPDGQTLAYVSFQNGQAEIYMMNIYSGKREKLTSFPRHNGA---RFSPDGKTLALVLSKTGNLQVYTMDLAT-----RRLTEVTSGRSNNTEP---------------------------------------------FWHPDGKSLIFTSDRGGKPQIYQVNLSGGETKRLTW---------QGSQNLGGQITPDGKFLVMVNRSDSGFNLAKQDLETGAMQILTKTLLDESP---SIAPNGGMVIYSSIYNKANVLSMVSIDGRFKARLPATNRVRAPAW...... 446
33 -15.300[R] KOG1188 WD40 repeat protein  ali follow..  10  39.KENLVAVLCSNGSIRIYDKERLNVLREFS--GYPGLLNGVRFANSCDSVYSACT-DGTVKCWDARVAREKPVQLFKGYPSNIFISFDINCNDHIICAGTEKVDDLVFWDARMNSQNLSTTKDSHSDDVTQVRFHPSNPNMVVSGSSDGLVNVFDINIDNE---EDALVTTCNSISSVSCIGWSGKGYKQIYCMTHDEGFYWWDLNHLDLNIQDVREVVNMKEDALDYLIGGLYHEKTDTLHVIGGTN-KGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGED-AQLLLWKPGAIEKTFTKKESMKIASS......... 368
34 -15.300[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  10  10.....................ENKNIYATLPRTQRGQPIVLGADPKGKNFLYTN--GNSVIIRNIENPAIADVYTEHS---CAVNVAKYSPSGFYIASGD-ASGKIRIWDTVNKEHLLKNEFQPIAGPIKDISWSPDNQRIVAVGEGRERFGHVFMSETGTSVGEISGQSKSINS-----ADFRPARPFRIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFV----------QAVRYSPDGKFF-ASAGFDGKVFLYDG-TSSELVGEFGSPAHKGGVYALAWKPDSTQLLTCSG-DKTCRLWTVESRE....................... 272
35 -15.300[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  10  69....LLLSSGFDRQIYIWQVYEDCENVMA-MSGHSGAVMEAHFTPDGSHIFTCST-DKTLAFWDIATGQRQRRFKGHGNFVNS---VQGSRRGQQLLCSGSDDRTIKIWDARKK---HAAHTLESPFQVTAVCFGDTGEQVISGGID-NEVKIWDIRKQAVLHHLRGHSDTITG------MSLSPEGDFI-LTNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKN--LLRCAWSPGSDKI-TSGSADRHVYIWDVNTRRILYKLPGHNGS----NAVDFSPKEPLILSGSSD-KTLYLGEIDE......................... 347
36 -15.300[R] KOG0645 WD40 repeat protein  ali follow..  10  18....LFATSSQDKSVRIYNSNTYNLVHVIDGFHT-RSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAA--EGHENEVKCIAWSCNGNYLATCSR-DKSVWIWEATEDDEFDCLAVLQETQDVKVVTWHPTEDLLVSGS-YDNSICFWRDDGDDWALTCQLQGHTNT-----WALAFSPNGNTLASADN-DGNVFLWIKISSNEDVATIDSTNILRPALQEKGAVYTISWMNDATLCSAGG--DGKIVVYQREKHDEALWHVAYEQDHAH-NSLEYLRDDR--LLSGGDDGECRVWSFK.......................... 322
37 -15.200[T] KOG0279 G protein beta subunit-like protein  ali follow..  11  27.NSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRMTGHSHFVVLSSDGQFA-LSGSWDGELRLWDLATGESTRRFVGHT---KDVLSVAFSTDNRQIVSASR-DRTIKLWNTLGECKYTISEADGHKEWVSCVRFSPNTLVPTIVSASWDTVKVWNLQNCKLRNTLAGHSGYLNT------VAVSPDGSLCASGGK-DGVILLWDLAEGKKLYS-----------LEAGSIIHSLCFSPNRYWLCAA--TENSIRIWDLESKSVVEDLKVDLKAEAEKTSLNWSADGNTLFSGYTD-GVIRVWGIGR......................... 325
38 -15.200[R] KOG0646 WD40 repeat protein  ali follow..  11  1MEITVIASSSIDEGIGSWDLKTGTEQLQFK--PCASPAHGLTAVGEKFLALSARNTSGSIFYWSWTKPQAEVKSYPVEPIKA----LAANNEGTYLVGGG-ISGDIYLWEVATGKLLKKWHGHYRS--VTCLVFSGDDSLLVSGS-QDGSIRVWSLIRLFDDFQRQQGNTLNEHTMSVTDIVIDYGGCNAVIISSEDRTCKVW--SLSRGKL----------KNIIFPSVINALALDPGGCVFYAGAR-DSKIYIGAINATSGTQVLGSVSEKGKAITCLAYCADGNLLISGSE-DGVVCVWDPKSLRHVRTLIHAKGSRKGPV....... 312
39 -15.100[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  14  1...................MSLCGHTSPVDS---------VAFNSEEVLV-LAGASSGVIKLWDLEESKMVRAFTGHR---SNCSAVEFHPFGEFLASGSS-DTNLRVWDTRKKGCIQTYKGHTRG--ISTIEFSPDGRWVVSGG-LDNVVKVWDLTAGKLLHEFKCHEGPI------RSLDFHPLEFLL-ATGSADRTVKFWDLETF-------ELIGTTRPE---ATGVRAIAFHPDGQTLFCG--LDDGLKVYSWEPVICRDGVDMGWST-----GDFCINEGKFIGCSYY-RNSVGIWVSD--ISELEPYGAVSEDKNECMVKRFSV 269
40 -15.000[S] KOG0293 WD40 repeat-containing protein  ali follow..  12  288....YLASSSKDQTAIIWEISADGHISLKHTLVGHHKPIAILWSPDDRQVLTCGA-EEVIRRWDVDSGDCVHMYEKG---GISPISCGWYPDGQGIIAGMT-DRSICMWDLDGREKECWKGQRTQ--KVSDIAMTDDGKWLVSVC-KDSVISLFDREATVERLIEEEDMITS--------FSLSNDNKYI-LVNLLNQEIRLWNIEGDP------KIVSRYKGHKRSRFIIRSCFGGYKQAFI-ASGSEDSQVYIWHRSTGKLIVELPGHAGA----NCVSWSPTNLHMLASASDDGTIRIWGLDRIN....................... 565
41 -14.900[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  1......MSSCVNTSQTGPKKKISFIIRDEHEYSNRSAVSALQYDAQNGRLFTGGS-DTIIRTWSVPHHKDAFSARGGVRSPGKNSDMILCGHGKILISAS-NDTTVKVWNIERDNKHGFIDCIRTKDYVSCLAYAPIVEKAVSASFD-HNIFVYDINANFKTVNNLIGCKDS------YSLATTPNLSLVLGAGT-EKCIRLFDPRTNEKIMKLRGHTDNV----------RALVVNDDGTRA-LSAGSDATIRLWDIGQQRCIATCIAHEEG----WTLQVDSSFTTVYSAGK-DKMVVKTPLYDFT....................... 295
42 -14.700[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  66............NVILICRVDLHTNQPIGRRVIGTDLPYRMAIHPRQGGLICALPNSCRLFDWEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAE-DGTLRVFEWPSMKTL--LNESKTHASVKSLTFSESGKFLVSL--GAPLCRVWDVNASAAIA-----SLSKEKDEMFASCRFSVDNSYVAANTQRGGSIITWDTTSWRRRSSKLI---------KRNNSISAFNVSADGKLL-AVGTLEGDVLIIDSTKMQTNQIVKKAHLG----TALTFSPDSRCLVSVSFDS-RARLTVIKQKG....................... 351
43 -14.700[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  10  29.SDHLLVSSW-DKRVRLYDVSTN---SLKGEFLHGGAVLDCCFHDDFSGFSVG--ADYKVRRIVFNVGKEDILGTHDKAVRCFYTLCLFCDVTGQVITGSW-DKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVATAG-RHVNIYDLRNMSQPEQRRESSLKYQ-----RCVRCYPNGT-GYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDIVYSIAFHPIYGTFATGG-CDGFVNIWDGNNKKRLYQYSKYPTS----SALSFSRDGQLLAVASQEPEAIFVRSVNEIE....................... 341
44 -14.600[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  10  1MAAII--NQRVEQGESSMGGAKPALLHRIT--GHVARINDVILLSKDEGVWTASD-DRSVRLYLKR-DNDQFWPSIHHFMPVAPTSLYYSEETYKLLVGLI-NGNVYEFSVADDFNSMTESRKWTCGPISGLGFALSSELIFSC--SRDKSIVWHCSENSNKMGSYLLENSC--------TAMVIDLPFVFVGDH-GGHVTVLRIVDNQPNL-----VSKLSAH---TNAITSLTWDGNKKVLYSGS-SDHLIIMWDI--GGGRGEAYELNGHNGKVTTLCAAPAAKRLFSADEH-GKLMCWDMNCKR....................... 280
45 -14.600[B] KOG0264 Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1  ali follow..  11  109....................SVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAE----NCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFE---------SHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELSDFSWNPNEPWVICSVSEDNIMQIWQMAENI....................... 407
46 -14.600[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  12  429.....AVLSAAADSIKIWNRSTLQCIRTMT----CEYALCSFFVPGDRQVVIGTK-TGKLQLYDLASGNLLETIDAH---DGALWSMSLSPDQRGFVTGG-ADKSVKFWDFELVKDENSTQKLQLDEDVLCVSYSPNQKLLAVSLLD-CTVKIFYVDTLKFFLSLYGHKLPVIC------MDISHDGALIATGSA-DRNVKIWGLDFGDCHKSLFAHDDSV----------MYLQFVPKSHLFFTAGK-DHKIKQWDADKFEHIQTLEGHHQE----WCLAVSPSGDYVVSSSHD-KSLRLWERTREPLILE................... 712
47 -14.500[R] KOG0288 WD40 repeat protein TipD  ali follow..  11  245....TLFTGGQDRAVKMWDTNSGTLIKSLY--GSLGNILDMAVTHDNKSVIAATS-SNNLFVWDVSSGRVRHTLTGHT---DKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKG---YCTNTVLFTSNCNAICLSIDGLTVFSGHMD-GNLRLWDIQTGKLLSEVAGHSSAVTS------VSLSRNGNRILTSGR-DNVHNVFDTRTLEICGTLRASGNRLASNW------SRSCISPDDDYV-AAGSADGSVHVWSLSKGNIVSILKEQTSP----LCCSWSGIGKPLASADK-NGYVCTWT............................ 515
48 -14.500[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  12  180....ILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTE-HNVLRVYDVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSY-DGDIKIWDGISGRCINTIAEAHGGAAICSLEFTRNGKYLLSSGMD-SLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHTEDYVL-FPDEATTSLCSWNSRNGCRLTLNSL---------GHNGPVRYITHSPNGPAFLTCSD-DFRARFWYRRAN...................................................................... 422
49 -14.400[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  10  462.....LVSGSDDKTVKIWEIATG---RCIRTIETDEVVRCVAWCPNPKLSIIAVATGNRLLLVNPKVGDKVLVKKTDDLLAEAPRQVTWHGRGDYLATVMPEGANRSALIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVA--TQHNIRIYDLVKQELVKKLLTNSKWI------SGMSIHPKGDNLLVSTY-DKKMLWFDLDLSTKPYQTMR---------LHRNAVRSVAFHLRYPLF-ASGSDDQAVIVSHGMVYNDLLQNTHEKRDEFGVLDVNWHPVQPWVFSTGAD-STIRLYT............................ 784
50 -14.100[R] KOG2444 WD40 repeat protein  ali follow..  10  20....RLVVGFVDGSIRFYDTQQHEEFQEIWKFQTKSSIRGVDLDEHKKRVYAVTK-NRSLCVF--DIDTGKRVRCILKCHRSVPTAICTLPKSQQLATADE-SGEVKTWNLDPEVASENANIRKWQEQINDLKVDVKSNLLATS--SDGTLGAYDLRKAKLKMRSELMHSEL--------YSVCGTNRSVYVGGE-DGYVEVFNLNEYGNLLERVES--------GFEMGVNGIVELRSGLLGLTSQ-GSNRMRLLNVQPSKRLGYAGYHGDEKSDDDAITISTDKSTVFTMISMSCTIKKWDMGP......................... 308
51 -14.100[DO] KOG0305 Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits  ali follow..  140......LAIALGDTVYLWDASSGSTSELVTIDEDKGPVTSINWTQDGLDL-AVGLDNSEVQLWDCVSN----RQVRTLRGGHESRVGSLAWDNHILTTGG-MDGKIVNNDVRIRSSI-VETYLGHTEEVCGLKWSESGNKQ-ASGGNDNVVHIWDRSLASSKQTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKIKFWNTHTGACL---------NSVETGSQVCSLLWSQSERELLSSH-TQNQLTLWKYPSMSKMAELNGHTSR----LFMAQSPNGCTVASAAGD-ENLRLWNVFGEP....................... 421
52 -14.000[R] KOG0289 mRNA splicing factor  ali follow..  12  236....KILTGGADKNVVVFDKSSEQILATLK--GHTKKVTSVVFHPSQDLVFSASP-DATIRIWSVPNASCVQVVRAHE---SAVTGLSLHATGDYLLSSS-DDQYWAFSDIQTGRVLTKVTDETSGCSLTCAQFHPDGLIFGTGTMD-SQIKIWDLKERTNVANFPGHSGPI------TSIAFSENGYYLATAAD-DSSVKLWD-------LRKLKNFKTLQLDNNFEVKS--LIFDQSGTYLALGG---TDVQIYICKQWTEILHFTEHSGL----TGVAFGHHAKFIASTGMD-RSLKFYSL........................... 504
53 -14.000[R] KOG4227 WD40 repeat protein  ali follow..  13  57......................................NAIEFSNNGGQWLVSGGDDRRVLLWHMEQAIHSRVKPIQLKGESNIFCLAFNSGNTKVFSGG-NDEQVILHDVESS---ETLDVFAHEDAVYGLSVSPVNDNIFASSSDDGRVLIWDIRESPHGEPFCLANYPSA-----HSVMFNPVEPRLLATANSKEGVGLWD-------IRKPQSSLLRYGGNLSLQSAMSVRFNSNGTQLLALRR-RLPPVLYDIHSRLPVFQFDNQGYFNSCTKSCCFAGDRDQYILSGSDDFNLYMWRIPADP....................... 313
54 -13.900[R] KOG0286 G-protein beta subunit  ali follow..  12  69....LLVSASQDGKLIVWDSYTTNKVHAIP--LRSSWVMTCAYAPSGNFV-ACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCRFLDDNNIVTSSG--DTTCALWDIETGQQKTVFVGHTG--DCMSLAVSPDFNLFISGACD-ASAKLWDVREGTCRQTFTGHESDINA------ICFFPNGEAICTGSD-DASCRLFDLRADQELICF--------SHESIICGITSVAFSLSGRLLFAGY-DDFNCNVWDSMKSERVGILSGHDNR----SCLGVTADGMAVATGSWDS-FLKIWN............................ 340
55 -13.900[DK] KOG0973 Histone transcription regulator HIRA, WD repeat superfamily  ali follow..  11  6.........HDTGSILAIDCHPSGKKFITCGQKARTSNGLVVVSPDGKRF-AFGSDDSSVSVWEYVGLINSMGSITGGAQNMEVLTVEWSPNGKYLASGS-IDYRIIIYNARKLPDRITVLNDIQLP-VKGLSWDPIGKYLASLE-GDKKLRFWATDSWQCVKSVTEPFESNIEETMLTRLDWSPDGKYLMTPAAVRSLIKLIQRQT-AGHHKGTTCVRAMPRLIEANLKNGKRMQLT----CAAVGSRDKSISIWVFPGTLKPLFVINNIFN----TVMDFAWCGRNLLACSQD-GTVKVIHLSESV....................... 350
56 -13.900[R] KOG1539 WD repeat protein  ali follow..  11  243.GRPLLASGGSFGVISIWNLN-KKRLQSVIRDAHDSSIISLNFLANEPVLMSASA-DNSLKMWIFDTNDGDPRLLRFRSGHSAPPLIRFYSNGRHILSAG-QDRAFRLFSVIQEQQSRELSQRHISLAILACAISACGNFAVVGTAG-GWIERFNLQSGISRGSYFDMSEKRRYAGEVIGVACDSTNTLMISAGY-HGDLKVWDFKKRE-RLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSM-DGSLRIWDVILAKQIDGVHVDVPI----TALSLSPNMDVLATAHSDQNGVYLWVNQSMFSGLPSVESYASGKDVVNVKLPS. 675
57 -13.900[S] KOG0283 WD40 repeat-containing protein  ali follow..  11  418.....YLASGGADRIHVWEVQECELMSMNE--GSLTPIHPSLCDSSGNEITVVEK-KKKGKGSSGRRHNHIPDYVHVPETLDAILDLSWSKSQLLLSSSM--DKTVRLWDIETK---TCLKLFAHNDYVTCIQFSPVDENYFLSGSLDAKIRIWSIQDRHVVEWSDLHEMVTA-------ACYTPDGQGA-LIGSHKGICRAY--DTEDCKLSQTNQIDVQSNKKSQKRKITSFQFSPVNPSEVLVTSADSRIRILDGSEVIHKFKGFRNTCS-----SASYSQDGKYIICASEDS-QVYLWKNDFHR....................... 715
58 -13.800[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  10  31.....KLFSTCTNVVKVIDLADNTASYTIGDPEDELRITCTAVDKNRNRLLVAYN-NQIIREYSIPLTKPELARTWKTIHTAPILVMEFNEEGHLLATGS-ADHIVKVWNLTEQ---QCTHTLKGPSVVSAILFGKHEKLVVGYIEGQLNLYNIMRGAPKKLVNTWKSHNSHITA-----LLQVPDSRVVVALSR-DQTMSIHETETQ-------ETLRVLP----LYESIEGGAIGHNGNLFTVGEEG--VVKEFVIETAKLVRKKRIASSN----DHLAYDVVSNRFLAISA-EQNLIILDFENLK....................... 309
59 -13.800[R] KOG2394 WD40 protein DMR-N9  ali follow..  10  195.....LLIGLNSGDVYTVSYNKDGSVN-----NRQDRCTSISWVPGGDGAFVVAHADGNLYNKDGATESTFPAIRDPTQFQGSINSIAFSNDGAHLATVGR-DGYLRIFDFLTQKLVCGGKSYYGA--LLCCSWSMDGKYILTGG-EDDLVQVWSMEDRKVVAWGEGHNSWV------SGVAFDSNWSYRFGSVGQDTQLLLWDLEMDE-CKRDVPKLSPIIAHRVHTEPLSGLMFTQES---VVTACREGHIKIWTRPSESETQTNSSEANPTTALLSTSFTKDNKASLSSKI-ISGSTFKQ............................ 556
60 -13.700[R] KOG1334 WD40 repeat protein  ali follow..  11  281......................................STIHFNQRGTRL-ASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGDSTLAMCG-HDGQVRVAELINASYCENTKRVAKRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRPASKVVVTRENDKKVG--YTISMNPANIYQFAVGGHDQFVRIYDQRRIDKKENNGVLKKFTPHHLDFPTNITCVVYSHDGTELLASYN-DEDIYLFNSSLSDGAQYVKGHRNNDTIKCVNFYGPRSEFVVSGSD-CGHVFFW--EKSSSQIIQFMEGDRGDIVNCLEPHP. 572
61 -13.700[Z] KOG1523 Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC  ali follow..  10  14........................................HAWNRDRTQI-ALSPNNHEVHIYKKNGSQWVKAHE--KEHNGHITGIDWAPKSDRIVTCGA-DRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGS-GARLISVCYFEAENDWWVS--KHIKKPIRSTVLSLDWHPNNVLL-AAGSCDFKCRVFSAYIKEGSKMPFGQLMSEFGGSGTGGWVHGVSFSASGSRL-AWVSHDSTVSVADASKSVQVSTLKTEFLP----LSVSFVSENSVVAAGH--DCCPMLFIYDDRG....................... 278
62 -13.500[BL] KOG1009 Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats)  ali follow..  32.....LASAGVDTNVRIWKVDGKAIVEFLSNLARHTKANVVRFSPTGEIL-ASGGDDAVILLWKVNDNKEPEQIAFQDEDEAQLYDICWATDGNLMASAS-VDNTAIIWDVSKGQKISIFNEHKS---VQGVTWDPLGQYV--ATLSCDVLRVYSIQKKRVAFNVSKMLSGIGAEG--RRLSFTPDGSLLLTPAG-CVESGENVMNTTPCPGKATLAVRCCPVYFPVVETGVELMSLPYRLVFAVA--SEDSVLLYDTQQSFPFGYVSNIHYHT---SDISWSSDGAFLAISSTD-GYCSFVTFEKDE....................... 379
63 -13.500[S] COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system  ali follow..  10  256.ERVYFLSDHEGVG-NLYSVDLKG--KDLRRHTNFTDYYCRNASSDGKRIVFQNAGD----IYLYDPEKDSLTKLDPKFVNVMEYMNEAVVNGNYIALVSRGK----VFLMRPWDGPSVQLGKKQGVKYRQIQVLPNGDVIGVND--EDKLVILGKDGSEKVINKDFSRIERV--------KVSPDGKKVLLSNNKLE---LWVYEIDNDNARLIDK--------SEYDLILEFDWHPNAEWFYAFPEGYYTQSIKLAHIDGKVVRITTPYGYDFSP---SFDPDGRYLYFLAARHLDNDKVIFNLSFQRVVKP................. 547
64 -13.400[S] KOG0295 WD40 repeat-containing protein  ali follow..  10  120....IMASCSEDATIKVWDYETGQLERTLK--GHTDAVNDIAIDAAGKQL-VSCSSDLSIKLWDFGQTYDCLKSLKGHE--HTVSSVTFLPTGDFVLSASR-DHTIKQWDISTGYCVYTFRGHNDW--VRMIRISNDGTLFASAS-LDQTVTVWSFATKSAKLVLRDHEHAVEC------VEWAPDTAYTNVTGQQSTHILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYL-ISVADDKTLRVWELSAQRCMKAIEAHE---HFVSTVAFHQTSPFVITGSVD-MSCKVWECR.......................... 404
65 -13.300[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  51....ANLETLKDKKLKTQLASREKLYGKSA--KAAAKIEKWLLPAEAGYL-ETEGLEKTWRVKQVDILSSR-NQYDIVLPDFGPYKLDFTASGRHMLAGGR-KGHLALLDMMNM---SLIKEIQVRETVRDVAFLHNDQFFAAA--QKKYAYIYGRDGTELHCLKERGPV--------ARLRFLKNHFLLASVNM-SGQLHYQ--DVTHGGM--------VASIRTGKGRTDVMEVNPYNSVVGLGHS-GGTVTMWKPTSQAPLVQMQCHPGP----SSVAFHPNGHLMATSGKE-RKIKIWDLRKFE....................... 326
66 -13.300[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  10  1.........................MKPILLQGHERSITQIKYNREGDLLFTVAK-DPIVNVWYSVNGERLGTYMGH---TGAVWCVDADWDTKHVLTGS-ADNSCRLWDCETG---KQLALLKTNSAVRTCGFDFGGNIIMFSTDKQ-FVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHE-SGELNQYSAKSGEVLVNVKEHSRQI----------NDIQLSRDMTMFVTASK-DNTAKLFDSTTLEHQKTFRTERPV----NSAALSPNYDHVVLGG-GQEAMDVTTTSTRIGKFE................... 266
67 -13.200[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  12  275....LLLTSSWSGLCKLWSVPDCELKQTLR--GHASYVGGVALRPGVKAAMASGGHDGAVKLW--GFNNEESIADITGHMPHRVSKVAFHPSGRFLATACY-DSSWRLWDLEQKTEVLHQEGHAKP--VHCLSYHSDGSVLVTGGLD-AFGRVWDLRTGRCIMFLEGHLGAVFG------VDFSPNGFHI-ATGSQDNTCKIWDLRRR-------QPVYTIPAH---TNLISDVKYQQECGSFLVTCSYDSTTKIWSNKTWQPLKTLQGHDNK----ISVDIAPNSQYIATTSFDR-TFKLWSPDS......................... 553
68 -13.100[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  148.....LITGCQTGEFTLWNGTAFNFETILQ--AHDSAIRALKWASNEQWLLSADQ-GGYVKYWQPNMNNAHMFSAHK---DEAIRGLAFAPTDVKFATAS-DDGTARVWDFARYTEERVLRGHGAE--VRCIDWHPTKGLIATGSRDTQPVKIWDPKSGSCLATLQEHKSSV------MAVEFNKNGNWLLTGGR-DHLVKMYD-------IRMMKEMRTYRAH---KKEVISLAWHPIHEGLFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQA---WSMKWHPLGHILATGSND-NNTKFWARNRPGDTVEDI................. 428
69 -13.000[R] KOG1963 WD40 repeat protein  ali follow..  229.CGSACAVSDDEGKIHVINDISNEKFNPQILHWHANPLNGLSWALNGEYLLSGGQ-EGVLVLWQMETSHRQFLP----RLGSSILSIATSHDSD-SYALHLGDNSLVVIRAVDLAEQIHVSGINSFESVQFSSVSPNGELLLMSSSHSVSVQEYDLTKDSTIRKFEAARYSYSSVSKNSAVTSSRNGLYIATIDTWQTALKFWQFDSVQKTWVLMTRIDN----HGNLEVVTALKMMTSSNRFITVGT-DATLRIWALLPGSSAHSQASIKQRYGFSKALTCSLDDSIIGFG---GSCMHFI--NSETLEEISTVDLPHGGQLENAQFLN. 604
70 -12.900[A] KOG0285 Pleiotropic regulator 1  ali follow..  172......................................RSVAFDPSNEWFCTGSA-DRTIKIWDVATGVLKLTLTGHI---GQVRGLAVSNRHTYMFSAGD-DKQVKCWDLEQNKVIRSYHGHLHG--VYCLALHPTLDVVLTGG-RDSVCRVWDIRTKMQIFVLPHDSDVFS-------VLARPTDPQVITGSH-DSTIKFWDLRYGTNHKKTVRAMALHPKENDFVSASADVAVNEDGVMVTGGDKG--GLWFWDWKSGHNFQRAETIVQPGSLESEACYDQTGSRLVTCEGDK-TIKMWKED--EDATPETHPLNFKPPKEIRRF... 477
71 -12.900[R] KOG2321 WD40 repeat protein  ali follow..  10  25......LPNWISKRKLKKDYALSHRIELLQDFEYPEASNRIKCTRDGKYAMATGVYKPHIKVFDFAEMSLKFERHTDAENVQF---EILSDDWTKSVHLQ-TDRTVDFHSQG-----GIHYSTRIPKYGRDLKYHYPNCDLYLAAAG-DEVYRLNLEQGRFLNPLKIESAQIDSPTGGNVIDINPMHQLLAFGTD-AGSVEFWDPRDRSGILEIPSTVPSTPYSDNSRSVTA-LKYRNDGLNV-AIGLSDGATLLYDLRSSSPYMSKDQGYSMPIKSLHWMDSALDGTARVLSADSKIIKIW--EKDTGKPFSS................. 320
72 -12.700[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  10  68.RKQWVVAGADDMYIRVYNYNTMDKVKVFE--AHSDYIRCVAVHPTLPYVLSSSD-DMLIKLWDWEKGWACTQIFEGHS--HYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKG--VNCVDYFTGGDKPYLITGSDDTAKVWDYQTKSCVQTLEGHTHNVSA------VCFHPELPIIITGSE-DGTVRIWHATTYNYGLERVWAIGYIKSSRRVVIGYDEASMDNTGKIIWAKHNEIQTANIKSIGADYEVTSVKELGTCDLYPQSLKHNPNGRFVVVCGDGE................................... 375
73 -12.700[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  13  30......................................SSVRISPKKPYHVATT-SSVRLTLYDTVVCEPLNLFSRFKKGVCS---IDFRHDGRLLAIGGD-EGKVRIFDVEKTTGSSKVALRVMQASVKSVHFSPRGDTVFSMA-DDGKIKQYRVADTAYGVNAVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSKEKSLE-----------LDCEHPVESVLFLPGEQLIATA--AGPIVKIWDTTTGRQLTALQAHYKT----TSLRLATNSTCLLSAGID-RRVNAFRTTNYS....................... 279
74 -12.700[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  31.....LLAGTIKGSVFLWDLQTNRSALHFE--VGSDPITSLHHTPDR---LVTQEKGGTITMFSIGGSSYVKERSIPGNHRSALHTNTSKTNEQLLFYPC-EESSIGVLHVTDAAAPTQILVPDDPQLPKKPFECASQLFLLAGY-ESGHFLTWDISSSVILDVMELAQDATS-------VDYDPVTNRGIVGGP-TDKLISFSYQRSSMQMQLGSELCIKNPGV------NGVRIRPDQKVF-ASAGWDGRIRIFSWKSLRPLAVLTQHKNGG---MDLAFSSQQV-IMAAAGMDGQISLWDLYN......................... 323
75 -12.700[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  32....YALTCGKDRTIRLWNPHRGILIKTYK--SHGREVRDVHVTSDNAKFCSCGG-DRQVYYWDVSTGRVIRKFRGHD---GEVNAVKFNDSSSVVVSAGF-DRSLRVWDCRSHSVEPVQII--DTFLDTVMSVVLTKTEIIGGSVD-GTVRTFDMRIGREMSDNLGQPVNC--------ISISNDGNCV-LAGCLDSTLRLL--DRTTGELLQV-------KGHISKSFKTDCCLTNSDAHV-IGGSEDGLVFFWDLVDAKVLSKFRAHDLV----NSIDVDFYLRLLFFVAGDKRELPPE--GRLYVDF.................... 305

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 4 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.