current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [S] COG2975 Uncharacterized protein conserved in bacteria, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAELast
1 -42.600[S] COG2975 Uncharacterized protein conserved in bacteria  ali  100  1MGLKWTDSREIGEALYDAYPDLDPKTVRFTDMHQWICDLEDFDDDPQASNEKILEAILLVWLDEAE 66
2 -6.200[S] COG5420 Uncharacterized conserved small protein containing a coiled-coil domain  ali follow..  26  32LPVKWIEIEEVAEKTHAAYAELDGARRELAKMKT................................ 65
3 -5.370[S] KOG4067 Uncharacterized conserved protein  ali follow..  115IGVSLEPELTVAQQTPAVSTANDNKQFGQRMLENFFNYASSFGVAARDIPPIVPFSVVQNWYTNFQ 185
4 -4.950[Q] COG3653 N-acyl-D-aspartate/D-glutamate deacylase  ali follow..  16  139DNQTWSTPAEYIEAIDALPLGPNVSSLGHSDLRTAVLGLDRATDDTVRPTEAELAKMAKLLDEALE 205
5 -4.840[U] KOG3465 Signal recognition particle, subunit Srp9  ali follow..  11  6...SWDEFVDRSVQLFRADPESTRYVMKYRHCDGKLV............................. 39
6 -4.740[P] COG2703 Hemerythrin  ali follow..  19  1MLPKWDNSYSVHNAKIDEQHKKLFKLAA-NEVKELLAEFFNYMKDHFNDEEKYMQLIGYPNLEEHR 77
7 -4.620[S] KOG2765 Predicted membrane protein  ali follow..  16  18VDVVWVSSSELTKFLYNEANFDKPFFCTYFKTSMFSIYLLVI........................ 59
8 -4.550[O] KOG2292 Oligosaccharyltransferase, STT3 subunit  ali follow..  10  554..MSWWDYGYQIAGMANRTTLVDNNTWNNSH----IALVGKAMSSTEEKSYEIMTSLDVDYV.... 609
9 -4.480[R] KOG2173 Integral membrane protein  ali follow..  17  203.TMPWATVLEKVVQLQSSQCLCVVKDLSAHDMVMRLMRKENY----GMLNKGLLS........... 254
10 -4.420[R] KOG2891 Surface glycoprotein  ali follow..  13  125...DWDSYFRDARNMDEMKAGERPDTIHISHLMRWFCPRHSEHEENVKPSENIFKRIFEKF..... 183

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 4 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.