current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG3682 Predicted transcriptional regulator, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MHITAAEAHVMEALWRRSPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPLISHFAQHRPLKPDEVAKLKKLIDEMGELast
1 -60.600[K] COG3682 Predicted transcriptional regulator  ali  100  1MHITAAEAHVMEALWRRSPLSADELVAEVGAAQSWGEATVKTLINRLLKKKAIKSERAEGKHGYRPLVDRSAYVQAESQGLLDRLFDGQLAPLISHFAQHRPLKPDEVAKLKKLIDEMGE 120
2 -13.400[K] COG1846 Transcriptional regulators  ali follow..  16  40..LTPSEIHTIDAIGTDEGLLMKELAERLGVTKG----AVSQLVDRLEAKALVRRTAKVSRGIQVVLTDKGREAYRAHADMHAAFYEELQ----------QSFTKEEIAIFEQCVSKLRD 145
3 -13.400[K] COG3355 Predicted transcriptional regulator  ali follow..  22  23YGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTK----ASISKALNNLLDKGLIQREKA.............................................................. 76
4 -11.700[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  10  81..LSPIEILILHSI-RDREKKLADICLALDIE---DTHIATYAIRKLEKAGLLTTGKAAKEKTVKITAKGAEACAHYAQ---------IRERLLVDSTANARPSEETLSELAALLRFMSG 187
5 -11.600[T] KOG4603 TBP-1 interacting protein  ali follow..  15  10...AGAAGILLRYL-QNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDG---------IVALTAKVQSLQQSCRYMEAELKELSS 119
6 -11.300[K] COG4190 Predicted transcriptional regulator  ali follow..  20  67..LTPRVLELIEAIRQEEPASINETARVVDRD----VKNVHEELSRLAHLGIIFFEEDGQRKRPVVWFDE.................................................. 130
7 -10.800[K] COG1695 Predicted transcriptional regulators  ali follow..  15  1..MDRYAIKALVLL-SKKPRTLYQMSKEISTGVQVSHGTLMPMIRKLLQERYIDFETRGREKVYHLTERGSRFVESLGKIE....................................... 78
8 -10.800[P] COG0735 Fe2+/Zn2+ uptake regulation proteins  ali follow..  11  4PQLTKNQSLVMGALAHSGPMSAYTILDKLRDNGFRAPLQVYRALDKLLEYGLVHRLESLNAFVACSCPHEHEHDHGVTAFTICEGCG-----------QVTEFHDEVIEDRLSTLVRA.. 111
9 -10.600[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  14  109...NSNRARIYEYIKTRPGAYLSEIIEKA----GIDRGAARYHIKILKAHHKIEAYRESGKTRYFQ---NNSTYGEEEKKVVSALQNATNQRIISEIQNGKCNTNLALARISWYVKNLKE 226
10 -10.200[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  15  17IGLKKNEIRIYRLL-KRRGMRIREIQREL----GISERSVRTHVLNLYRRGLLKRQSGWLGYIYTPVSPLEQKIKEHLMKSIEEL................................... 103
11 -10.100[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  20  14MDTLKRHISVINVLLREQPIGIIKLSQET----GIPEHKIRYSLRILEQENIISPSREG............................................................. 68
12 -9.610[DR] COG5124 Protein predicted to be involved in meiotic recombination  ali follow..  6MKSDQKKSILLEIIRGSKSFFKLQELESLGSKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRCKELMEECERMSQDIKREYIENEKMSKHYTEERNELENKLNA 127
13 -9.610[DR] KOG3433 Protein involved in meiotic recombination/predicted coiled-coil protein  ali follow..  6MKSDQKKSILLEIIRGSKSFFKLQELESLGSKKGIVVNTIKEILQQLVDDGLVTAEKVGTSNLYWSFASEGIQKKKLRCKELMEECERMSQDIKREYIENEKMSKHYTEERNELENKLNA 127
14 -9.550[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  10  1..MKMKTLFLLIKLAKMGTVTMRELSREL----DVSPQTVLRWLEELKEQGYIHKRESRKGTLVELTEKGINLLEKLYEEI....................................... 81
15 -9.450[K] COG4738 Predicted transcriptional regulator  ali follow..  10  32LNINRPVALTLACLSKGDEISSQRI----EMVSGLRQPEVSIAMRYLRENEWVDMREEKKNKLYKLTVQMETIIDTIEENVIAES----------------KTILQNIERLKSL...... 132
16 -9.340[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  12  245.PLSPELCEVLDII-HKGRITQKDLRSKL----DYSEVKVSLMLSELEKRGLIRKLRNGRENILV--LVDEE................................................ 310
17 -9.120[K] COG2345 Predicted transcriptional regulator  ali follow..  10  15...GDTRRKILLILLERAPVIASDIAEQL----QLSTVGVRRHLDNLVEENLAEAANPRQNPYEPKMRGRPAKTYRLTDK--RSIFGHEYDSLAAAALAT.................... 106

FFAS is supported by the NIH grant R01-GM087218-01
1 3 2 7 9 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4.