current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG3788 Uncharacterized relative of glutathione S-transferase, MAPEG superfamily, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst MPSAILKGVCMVSALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVLMLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLWYMPWELVFSLRLast
1 -82.200[R] COG3788 Uncharacterized relative of glutathione S-transferase, MAPEG superfamily  ali  100  1MPSAILKGVCMVSALYAVLSALLLMKFSFDVVRLRMQYRVAYGDGGFSELQSAIRIHGNAVEYIPIAIVLMLFMEMNGAETWMVHICGIVLLAGRLMHYYGFHHRLFRWRRSGMSATWCALLLMVLANLWYMPWELVFSLR 141
2 -36.200[S] COG3686 Predicted membrane protein  ali follow..  10  1.........MTIAFWCVLIAIFLPYVCTSIAKFGGEGYGGRANADPRAFRRRANNAQLNAFEVTPAFAAAVIIAHLVGASQATLDSLAIAWITSRLLYVICYLADWGPLRSLVWFVGMLLIAAFFVVS............. 127
3 -33.500[S] COG5331 Uncharacterized protein conserved in bacteria  ali follow..  12  6...........AMFWPMIAHAFLVFILYALLLHRRKNHQYRERGEEGQASYLVNRNIANQFELPVLFHAICLLLYITDADNVVTVVLAWLFVISRYAHSYVHVTSNLRYRAPLFGIGFALLVCLWGWLAIWLALE...... 139
4 -8.740[O] COG5264 Vacuolar transporter chaperone  ali follow..  11  112.............................VSGPIKVEAKVWLANE---------RTFLKWLH-VVVLLGSLALALYNSAGERLGQAFGVVYTIFIGFYAWKLHAKRSKSRSPAPMTDYWGPLIVGTALAISLIVNMSFALK 219
5 -8.680[S] KOG4502 Predicted membrane protein  ali follow..  12  536RSSLVYQILLSLQKTLSIVYFLVIFILYF------KGAILPYPRY--EYLRINWGSRGNLLESTAFLALSTVLS--------IPIIIILVYLEFFQNYVLFI-----------EIFTYVMGFFVILETLLSLVLTITFS.. 664
6 -7.200[I] KOG3146 Dolichyl pyrophosphate phosphatase and related acid phosphatases  ali follow..  10  57...........FFGIGLVISQFINEFIKTSVEQARPETCTLLEACDSHGW----SSHSQFMFFFATYFSLMGCKGIGFWFGLLHWSLAVVTMYSRVYLGYHTVAQVFAGAALGGIVGASWFWVV................. 174
7 -6.680[B] KOG3118 Disrupter of silencing SAS10  ali follow..  10  197SPDLPRTELLKILEAKHPEFQLFLDELNQLKPQLNEIKEKLKTYPSSQLLQAQCTALSTYISFLTFYFALLKDGEEDKNHPIMVDLVRCKQTWESY............................................. 293
8 -6.620[KB] KOG3265 Histone chaperone involved in gene silencing  ali follow..  1........................MASRVNIVQVQILDN-PAMFVDKFKMEITFEVFEHLPHDLEWELVYVGSGTSRDFDQVLDSALVGPIPEGRHKFVFDAEHPDISKIPVEDIVGVSVLLLRCKYNDQEFINMGWF... 113
9 -6.520[A] KOG0113 U1 small nuclear ribonucleoprotein (RRM superfamily)  ali follow..  1MTQYLPPNLLALFAAREPI----YLGVAKFMADFEDPKDTPLPKTVETRQERLERRRREKAEQVAYKLEREIALWDPTEIKNATEDPFRTLFIARINYDTSESKLRREFEFYGPIKKI....................... 131
10 -6.520[KB] COG5137 Histone chaperone involved in gene silencing  ali follow..  1.........................MSIVNILSVNVLNN-PAKFSDPYKFEITFECLEPLKSDLEWKLTYVGSATSQSYDQILDTLLVGPIPIGI--NKFVFEADPPNIDLLPQLSDVLGVTVILLSCAY........... 102

FFAS is supported by the NIH grant R01-GM087218-01
1 3 0 5 6 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.