current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [R] COG4221 Short-chain alcohol dehydrogenase of unknown specificity, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240
# Score Template Links and tools%idFirst MSESLQGKIAVITGAASGIGLATTEALLEQGATVVMVDWNEKALNDLAAKLGERAIPQVTNLLDADSCNAMIPEILGKVDHIDILYCNAGTYIGGDLTETTPEAIDKMLNLNVNAVMKNVQAVVPHMSERKTGDIIVTCSIAGHFPTYWEPVYSGSKWAITSFVQGMRRQMIPHGVRVAQVSPGPVVSALLADWPEENLRKAKESGSLIDASEVADAVVYMLTRKRTVTIRDMLVLPTNFDRVLast
1 -91.500[R] COG4221 Short-chain alcohol dehydrogenase of unknown specificity  ali  100  1MSESLQGKIAVITGAASGIGLATTEALLEQGATVVMVDWNEKALNDLAAKLGERAIPQVTNLLDADSCNAMIPEILGKVDHIDILYCNAGTYIGGDLTETTPEAIDKMLNLNVNAVMKNVQAVVPHMSERKTGDIIVTCSIAGHFPTYWEPVYSGSKWAITSFVQGMRRQMIPHGVRVAQVSPGPVVSALLADWPEENLRKAKESGSLIDASEVADAVVYMLTRKRTVTIRDMLVLPTNFDRV 243
2 -79.700[IQR] COG1028 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  25  3...KLTGKTALITGASQGIGEGIARVFARHGANLILLDISDEKLADELGGRGHRCTAVKADVRDFASVQAAVARAKETEGRIDILVNNAGVCRLGNFLDMSEEDRDFHIDINIKGVWNVTKAVLPEMIKRKDGRIVMMSSVTGMVADPGETAYALSKAAIVGLTKSLAVEYAQSGIRVNAICPGYVRTPMAESIARTEMAKAIPLRRLADPLEVGELAAFLASDESSYLTGTQNVIDGGSTL. 255
3 -79.400[R] KOG0725 Reductases with broad range of substrate specificities  ali follow..  20  2.......SCALVIGATSTLGKAVVRRLAFTGYKVAAAADCPNSVGKVAEDNGGDVTAFSLDVANAEHRKELITKVAEKLGGLDTLIIVPPQNVLGEIIETSGEDFDKLFANNLTTPFRLSQAAMSTLAKSQNGSIIYLTSCFGFTPSIDMGLYSVASSSVLSLTKSVAQSAAKQGVRVNSVVSGMIEGDGTGAVWDQHLESMIPLGRLGRPSDVASYVEFLASTKARYITGENCIVGGGVSY. 251
4 -70.600[I] KOG1200 Mitochondrial/plastidial beta-ketoacyl-ACP reductase  ali follow..  23  70VVQKVESPVVVITGASRGIGKAIALALGKAGCKVLVNYRSAKEAEEVAKQIGGQAITFGGDVSKATDVDAMMKTALDKWGTIDVVVNNAGITRDTLLIRMKQSQWDEVIALNLTGVFLCTQ-----------GRIINISSVVGLIGNIGQANYAAAKGGVISFSKTAAREGASRNINVNVVCPGFIASDMTAELGEDKILGTIPLGRYGKAEEVAGLVEFLASPAASYITGQAFTIDGGIA.. 307
5 -69.800[Q] KOG1204 Predicted dehydrogenase  ali follow..  22  2......GKVILITGASRGIGLQLVKTVIEEDDECIVYGRTEAGLQSLQREYADKFVYRVLDITDRSRMEALVEEIRQKHGKLDGIVANAGMLISQSNSEHDIKQWERLFDVNFFSIVSLVALCLPLLKSSPVGNIVFVSSGASVKPYNGWSAYGCSKAALNHFAMDIASEEPSDKVRAVCIAPGVVDTQMQKDIREERFTQLYKTSSLLDPKVPAAVLAQLVKGIPDSLNGQYLRYNDERLG. 259
6 -67.600[I] COG0623 Enoyl-[acyl-carrier-protein] reductase (NADH)  ali follow..  15  2..GFLSGKRILVTGVASSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQVNAVTREGFKIAHDISSYSFVAMAKACRSML--NPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIA 254
7 -67.600[R] COG0300 Short-chain dehydrogenases of various substrate specificities  ali follow..  23  1....MRKKTIFITGASSGLGRQLAIDFSWEETVLCLFARSQERLENVQRIVGGEAHIYPVDLADPQSIDRSFAEAISAVGVVDVLINNAGYGVFEPFCDSQMDENERMFRVNVFGLMRATAAVLPTMREQGSGHIINIASQAGKIATAKSAIYSATKHAVLGFTNSLRMELKGTGIHVSAVNPGPIQTPFFDQADKEGAYTSKVQRIMLDPEDVSEKIVQLTKKPKRELN............. 229
8 -58.700[M] COG3967 Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein)  ali follow..  21  2...KMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAEAKQQL-PNIHTKQCDVADRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEEVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHHVRDTSVEVIEMAPPMVDTGLNQKSRDKQGLTYRGI----SSEEYVQYFLDGLKEGKQEIT............. 225
9 -57.600[Q] KOG1201 Hydroxysteroid 17-beta dehydrogenase 11  ali follow..  21  48..KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELNQKDIHVTTVLPSFLRTNSDVTQLTHT-IGFGDVYPLFTGEEVAQRIVAGMVRGEAEIT............. 281
10 -57.400[Q] KOG1210 Predicted 3-ketosphinganine reductase  ali follow..  22  29...ALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIKQVVLCISVDVSDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSS............. 266
11 -57.300[I] KOG1206 Peroxisomal multifunctional beta-oxidation protein and related enzymes  ali follow..  21  316KIKSLCNKVVVVTGAGGGLGKSHAIWFARYGAKVVVNDIKPFSVVEEINKLYGEGTAIPDSHDVVTEAPLIIQTAISKFQRVDILVNNAGILRDKSFLKMKDEEWFAVLKVHLFSTFSLSKAVWPIFTKQKSGFIINTTSTSGIYGNFGQANYAAAKAAILGFSKTIALEGAKRGIIVNVIAPHAETAMT------KTIFSEKELSNHFDASQVSPLVVLLASEEGRRVIGQLFEVGGGWCG. 557
12 -55.000[Q] KOG1209 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases  ali follow..  27  1MESGDESPVVLITGCSQGIGHALAREFTEKGCRVVATSRSRSTMTDLEQD--SRLFVKELDVQSDQNVSKVLSEVIDKFGKIDVLVNNAGVQCVGPLAETPISAMENTFNTNVFGSMRMTQAVVPHMVSKKKGKIVNVGSITVMAPGPWAGVYTATKAAIHALTDTLRLELRPFGIDVINVVPGGIRTNIANSAVARERAFISQRMNPTPAETFARDTVAAVLKKN................. 263
13 -54.700[Q] KOG1205 Predicted dehydrogenase  ali follow..  24  42.SEKVNGKVVIITGSSSGIGEHLAYEYARRGAYLTLVARREDRLQVVADRCSPDVAVVRGDVSVIKDCKRFVQETISRFGRLDHLVNNAGIAEAKFFEDYSESDVLPIVNTNFWGPVYATHFAIPHLKKTK-GKIIAVASPAGWSGVPRMSIYAASKAAMINFYETLRIELHP-EVGVTIVFPGLIENGNTNPDSLLQKQDWSQVVTIESAAECAKAVVNGICRGKTFVA............. 277
14 -48.500[IR] KOG4169 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases  ali follow..  19  2...DLAGKNVVYLGGFGGIGQKCVQELLQRPIKLAIFDLNANEQLLAKWKSDTDVFYHKLDITQKSDIDAAYKATAERFGHFDVVVNGSGL--------MNDRLVELTIQINLLGVINSTLTALEYMDKAKGGLIVNISSVAGLQPTAIMAIYSAAKTGVTTFTRAMANPYAHSGVGFLTICPGFTDTGLLEDIGNTPMLAMFNRVKRQKAEDCARNLVSAIETSKNGTVLMLEMGETTEGLA 249
15 -46.200[I] KOG1014 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3  ali follow..  23  48......GQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIGRSVKIIQADFTKDDIYEHIKEKLAG---EIGILVNNVGMLPNPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVI--------TKTADEFVKESLNYVTIGGETC.............. 266
16 -46.100[QR] KOG1610 Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases  ali follow..  24  26...HLQDKYVFITGCDSGFGNLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGGLWGLVNNAGILPITLCEWLNTEDSMNMLKVNLIGVIQVTLSMLP-LVRRARGRIVNVSSILGRVA-FFVGGYCVSKYGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNM.................................................. 216
17 -43.500[R] KOG1611 Predicted short chain-type dehydrogenase  ali follow..  13  1....MSPKSVVVTGSNRGLGFGLVQQFLKDPNHVIATARDVDKATALKGICDPRLHILQLSLGSDESIANFAEKVSEIVGELTLLINNAAVMLPVTKQKPDRKVVLDLFESNTIGPMMLTQSLVPLIIKSRGAIINIASEFLGSISENTSGAYRMTKCAVNQFTKTLSIDLKDDHILTAGICPGMVQTDMSKG------------KGQLTIEESSSQILAAFNKLGATHNGGYFRRDL..... 246
18 -42.200[Q] KOG1208 Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases)  ali follow..  23  43...SAKGLVAVVTGSNCGIGFETVRELNLRKADVYMLCRSEEKANEAKRMLATRLHFIECDLTDFESVRRAAKETLESTDTIDILINNAGIMFQSKH-EQTKDGHEKTWQSNHLGPFLLTELFLPAVKKSSYARIINVSSRIHLKSFGMMKSYRQSKLANVMHARALTKELRKDGVTVNSLHPGVVNTELARNTILNTPGIKQITAVFRTSRDGAQTSIFLALGKK................. 291
19 -39.900[I] KOG1478 3-keto sterol reductase  ali follow..  20  3.......KVVLITGASSGIGLALCKRLLAEDLHLCLACRNMSKAEAVCAALTAEVTIVQVDVSNLQSVFRASKELKQRFQRLDCIYLNAGIMPNPQLNKITADGLQEVFETNVFGHFILIRELEPLLCHSDNSQLIWTSSRSARKSSKGKEPYSSSKYATDLLSVALNRNFNQQGLYSNVACPGTALTNLTYGILPP-LLRFFANAFTLTPYNGTEALVWLFHQKPESL.............. 279
20 -38.200[S] COG3007 Uncharacterized paraquat-inducible protein B  ali follow..  13  38...ANGPKRVLVIGASTGYGLAARITAAGCGADTLGVFFERPAFHKFAAQKGLYAKSINGDAFSDEIKQLTIDAIKQDLGQVDQVIYSLASPRNSALKPIGNAVNLRGLDTDKEVIKMWIDALLDAGVLAEGAQTTAFTYLGEKITHDWNGSIGAAKKDLDQKVLAIRESLAAHGGDARVSVLKAVVTQASSAIPMMPLYLSLVMKEKGTHEGCIEQVYSLYKD---SLCGDSPHMDQE.... 327
21 -38.100[I] COG4982 3-oxoacyl-[acyl-carrier protein] reductase  ali follow..  19  352DRGLYSSEIAVVTGASKGIAASVAARLLDGGATVIATTSKLRALYRDHARYGAALWVVAANMASYSDIDALVEWIGNEAQTPTLLFPFAAPRVIGDLSEAG-ARSEIEMKVLLWAVQRLIVGLSKIGTERDVASHVVLPGSPNRGMFGGDGAYGEAKSALDAVVSRWHAESWAARVSLAHALIGWTRGTGLMGHNDVIVSAVEEAGTTYSTDEMAAMLLDLCNAESKVAAAGTPILTGGLGEV 623
22 -17.500[C] KOG2865 NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit  ali follow..  14  64..SSVSGIVATVFGATGFLGRYLVQQLAKMGSQVLVPFRGSEDSPRHLKLMGGQVVPMKFDPRDEDSIKAVMAKA-------NVVINLIGR-----EYETRNFSFE---DANHHI----AEKLALVCEHGGIMRYIQVSCLGA--SVSSPSRMLRAKAAAEEAVLN-------ALPEATIMRPATM-SMFVKKYGFLPLIGGGTTKYPVYVVDVAAAIVAALKDDGS-SMGKTYELGG..... 282
23 -16.400[IE] KOG1430 C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases  ali follow..  12  1MGNK-SGEVLLVTGGSGFLGQHLIKQLLERKEELGIKEIRSLDIVPYKNNIGHERTYVADIGGDLKALSPIFN-------GVDGVFHCAAS-----VKIEYPPNYEELERVNVNG----TLAVVDLCIQNNVKRLVYTSCTSVCFVPFKGPGYASSKLRAENISNGAPLHNQKEYLATSAMRAGECDSHFITEIFDFLSTRGWVFPRIAGVGNVAWGHICAYKVSDKAVNGLPVFVTDD.... 280
24 -16.200[V] KOG1502 Flavonol reductase/cinnamoyl-CoA reductase  ali follow..  16  1MANSGEGKVVCVTGASGYIASWLVKFLLSRGYTVKASVRDPSDPKKTQHLVKERLHLFKADLLEQGSFDSAID-------GCHGVFHTA-----SPFFNDAKDPQAELIDPAVKGTLNVLNSCAKASSVKR---VVVTSSMAAVGYNASKMWYVLSK----TLAEDAAWKLAKEGLDIVTINPAMVIGPLLQPTLNTSAAAILNL-GWVNVKDVANAHIQAFEVPSA................ 247
25 -15.500[MG] COG0702 Predicted nucleoside-diphosphate-sugar epimerases  ali follow..  12  34.....LPPLVTVFGGSGFVGRHVVRMLAKRGYRIRVAVRRPDLAGFLQP---GQISFAQANLRYRDSIIKAVE-------DADHVVNCVGI-----LAESGRNTFD---AVQEFGAKAIAEAA-----RDTGATLTHISAIGA--DANSQTGYGRTKGRAEAAIHSVLPGAV---LRPSII--GPEDDFFNKFAKMARNLPFLPLIGGGKTEDVAEAVARSVDGKLK--PGAIYELGG..... 247
26 -15.100[M] COG1089 GDP-D-mannose dehydratase  ali follow..  15  2......TKVALITGVTGQDGSYLAEFLLDKGYEVHGIKRRIDHIYQDPHGSNPNFHLHYGDLTDSSNLTRILKEV-----QPDEVYNLAAMSH----VAVSFESPEYTADVDAIGTLRLLEAIRFLGLENKTRFYASTSELYGLVQEI-RSPYAVAKLYAYWITVNYRESYGIYACNGNHESPRRGETFVTRKITRGLANIAQSLRDWGHAKDYVRMQWLMLQQEQ----PEDFVIATG.... 254
27 -15.000[R] KOG4288 Predicted oxidoreductase  ali follow..  11  3.........IVVLGGSGFLGHNICKLAIAKGYEVVSVSRRGAGGLHNKEPWMDDVEWETLDAKDPNSLLPVLR-------DASAVVNSVGILMENNYKKILQNPRGPVSHINRDLAIETAKIA----AKANVPVYCYVSAHAAAPGLD--PRYIKTKREAEREISKIS------NLRSIFLRPGFM-SSINRATSGALNFLGTASAEPLPSEEVALAALEAISDPS................. 254
28 -13.100[MG] COG0451 Nucleoside-diphosphate-sugar epimerases  ali follow..  11  3.........YLVTGTAGFIGFYVAKRLLDAGHFVTGFDGMTKYYDVSLKEKSNGFRAEIGMLEDTDALKRAAEAA-----EPEIIIHLAAQA-----VRYSLENPRAYIDSNLIGSFNMLELARSLKVKH-----LMLASTSSIYGANEKTLYAATKKSMELMAHSYAHKLPTTAFRFFTVRPDMAPIKFVDAVSNGQPIDIYGQGNMSRDDDLVEGIVRLSAVIPS................ 237
29 -12.500[M] KOG1371 UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase  ali follow..  14  95.......THVLVTGGAGYIGSHAALRLLRDSYRVTIVDNLSRGNLGAVKTLTGRLQFIYADLGDPLAVEKIFSE------AFDAVMHFAAVAYVGESTLYPLKYYH----NITSNTL----GVLEAMARHKVKKLI-YSSTCATYGEPEKNPYGKAKKMAEDMILDFSKNSDMAVMILRYFNV............................................................ 274
30 -12.300[G] KOG0747 Putative NAD+-dependent epimerases  ali follow..  14  2..ASYTPKNILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPNFKFVKGDIASADLVNHLLITE-----GIDTIMHFAAQTHVDNSFGNSFE----FTKNNIYGTHVLLEACIRRFIHVSTDEVYGETDEDALVGNHETNPYSATKAGAEMLVMAYGRSYGLPVITTNVYGPNQFPEKLIPKFILLAMRDGSNVRSYLYCEDVAEAFEVVLHKGE---VGHVYNIGTK.... 253
31 -12.300[Q] COG3321 Polyketide synthase modules and related proteins  ali follow..  16 1762......DGSYIITGGLGGLGLFFASKLAEAGCGIVLTARSARQTIERLCAAGADIVVECGNIAEPYTADRLVNAATATGLPLRGVLHSAAVVEDATLTNITDELIDRDWSPKVYGSWNLHCATIGQPLD----WFCLFSSGAALLGSPGQGAYAAAN----SWVDLFAHWRRAQGLPVSAIAWGA.......................................................... 1938
32 -12.000[M] COG1087 UDP-glucose 4-epimerase  ali follow..  21  3.........ILVTGGAGYIGSHTCVQLIEAGHEVVVVD-HPEALHRIEKITGRAPRREPGDIRDRALMEQMIKR------KCTAVIHFAGLKAVGESSEKPLLYYD----CNVLGTLRLLQAMEATGVKK-----LVFSSSATVYGDPDKNPYGRTKLVIEDMLRDLYNS......................................................................... 165
33 -11.900[M] COG1088 dTDP-D-glucose 4,6-dehydratase  ali follow..  15  2.......RKILITGGAGFIGSALVRYIINETSAVVVVDKNLMSLAPVAQS--ERFAFEKVDICDRAELARVFTE------QPDCVMHLAAESH----VDRSIDGPAAFIETNIVGTYTLLEAARAYWNALTEDK-ISTDEVYGDLHSTDSSPYSASKASSDHLVRAWLRTYGLPTLITNNYGPYHFPEKLIPLMILNALAGKQQIRDWLYVEDHARALYCVATTGK---VGETYNIGGH.... 254
34 -11.500[GO] KOG1431 GDP-L-fucose synthetase  ali follow..  14  1MGEPQGSMRILVTGGSGLVGKAIQKVV-ADGAGLPGEDWVFVSSKDA-------------DLTDTAQTRALFEKV-----QPTHVIHLAAMVGG---LFRNIKYNLDFWRKNVHMNDNVLHSAFEVGARK----VVSCLSTC--PPHNSNFGYSYAKRMIDVQNRAYFQQYGCTFTAVNVFGPGHVLPGLIHKVHLAKSSGSNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEVSI 252
35 -11.200[E] COG1748 Saccharopine dehydrogenase and related proteins  ali follow..  10  1MKKNV-----LIIGAGG-VAQVVAHKCAQNSGDIHIASRTVDKCRKIVESVREKLEAHALDALDVEATKALIVST-----GSQIVINVGSAFVNMSVLRACMDT---------------------------GVAYMDTAIHEEPNKICETPPWYGNY------EWKRAAECKEKGITA-GFDPGVVNA....................................................... 158
36 -10.900[R] COG2910 Putative NADH-flavin reductase  ali follow..  13  3.......KIALI-GASGNAGSRILKELSDRGHQVTAIARNPEKIAAL-----PNVVAKKGDVFDQAALSELLKGH-------DAVISSVHFTASD------------------------PATLIEAVRASGVQRYLVVGGAGSLEIAPGQRVVDLPKAEATKGAEFLDKLKQEKQLDWTFLSPSAEFVP--KFRIGKDNLLSNEQGSRISFEDYAIALADEIEKPQ................. 193
37 -10.400[GM] KOG1429 dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase  ali follow..  15  28....QSNMRILVTGGAGFIGSHLVDKLMQEKNEVIVAD---NYFTGSKDNLKKWIGHPRFELIRHDVTEPLFV-------EVDQIYHLACPASPIFYKYNPVKT----IKTNVIGTLNMLGLA------KRVGARILLTSTSEVYGDPLVSCYDEGKRVAETLMFDYHRQ---HGIEINTYGPGRVVSNFIAQALRGEALTVQKPGTQTRSSDMVEGLMRLMEGDQTGPIN............ 265
38 -10.200[MG] COG1086 Predicted nucleoside-diphosphate sugar epimerases  ali follow..  14  275LQKNITEKSVMVTGAGGSIGSELCRQILAKPKTLVLFELNEYNLYTIDQELQAKIVAALGSVQRENRVKKLMQA------QVETVYHAAAYKHVPLVEDNVIEG----IRNNVFGTLACANAAIEAGVKNSTDKAVRPTNIMG-----------ASKRMAELVLQALADKNSTTIVRFGNVSSGSVVPLFKKQIRAGGPVTVTHPDIIRYFMLIPEAAQLVIQAGAMSHNGQVFVLDMG.... 512
39 -10.200[R] COG1090 Predicted nucleoside-diphosphate sugar epimerase  ali follow..  15  35.........IILTGATGFVGCSLVPLLHQQGHELTLLVRSVSKAQRFAPGSFPQLKAIAYEATKSGDWQKVVD-------GQDAVINLAGEPISER----TEAYKAEIFDSRKLGTEKLVEAI---AKADRKPQVMISGSAIGYYGTSETATFTESSKPGDDFLENAAHQVEQLGVRLVVFRIGIVLGADGGALAKMLPPFKLFAGSWIDRRDLIALIDKALTDST................. 256
40 -9.980[G] KOG1203 Predicted dehydrogenase  ali follow..  18  121.....TSGIILVAGATGGVGRRIVDILRKRGLPVKALVRNEEKARKM---LGPEIDLIVADITKENTL------VPEKFKGVRKVINAVSV........................................................................................................................................................ 197
41 -9.770[S] COG3268 Uncharacterized conserved protein  ali follow..  13  1MSPDKREFDIVLYGATGFSGKLTAEHLALSTARIALAGRSSERLRNVRALLGPNA-LIVADASQPSTLEAMAGRA-------QVVLTTVG-----PYTRYGLPLVAACARADLTGELMFCRNSIDLHHKQAAATGARIILACGFDSVP-------SDLNVYQLYRRVIEDRTGELCDTDLVSGGSVAA....................................................... 188
42 -9.650[T] KOG4039 Serine/threonine kinase TIP30/CC3  ali follow..  12  235DHIVIKMSSAFVVGATGAVGSELVKLLAESTKFSKVVVLARRPVDGATGD---KLIQKTVDFDKLEENAEDIQGVDVAFCALGTTRGKSG---------------DGFYKVDHDYVMSAAKMA----KENGVKQFVLVSSVGA--DASSRFLYPKTKGEVEKEIGELNFE------KFVIMRPGLIEAKRPEFRIGEFLGKIVSNRFSSSATAIAQAMINATQTEET................ 439
43 -9.620[R] KOG1196 Predicted NAD-dependent oxidoreductase  ali follow..  13  156.....KGDTVFVSAASGAVGQLVGQFAKLMGCYVVGSAGSKEKVDLLKNKFGFDD---AFNYKEEHNLIGALKRCFPE--GIDIYFENVG----GKMLDAVILNMRPHGRIAACGMISQYNLKNPEGIYGLSLITYKRIRIEGFNCFDYFHKYSEFLEFVVPYIKEGKIKYVED------VADGLESAP-------------AALVGLFHGKNVGKQLVVVSPS................... 346
44 -9.520[R] COG2130 Putative NADP-dependent oxidoreductases  ali follow..  17  141IMHPKPGQTVAVSAASGAVGSVVGQLAKLKGCRAVGFAGGKDKCDYVVNELGFDACIDYKAAKDPKELYAMLKEATPD--GIDAYFENVG----------------------------ILDAVLRRM--NPFGRIAMCGMIAG---------YDGQPLPLQNPQLILVSRLTVEGFIVSEHMD---------PEALRELGGSVAQGKLKFRESVAQGLASAPEAFIGLLKGK........... 326
45 -9.090[S] KOG2733 Uncharacterized membrane protein  ali follow..  14  1MSGD-----VIIFGASGFTGKYTVFEAVTRGLRWGIAGRNREKLEAVLKEMGAKA-IFIADVNDQASLLEMAKKC-------RIVVNTAG-----PYRFHGENVVKCCIEVDVSGEPQYMETMQLRYDQLAREKGVYVVSACGFDSIPA.............................................................................................. 149

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.