current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [V] COG4257 Streptogramin lyase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .
# Score Template Links and tools%idFirst MLATRREPVGTAAKRRPGSGPALSFASALVGAALIIAMGSAPAQPPSFDTFAVPAGSAPHDVAPAPDGTVWYTAQAQGAAGRLDPRSGKADRVPLGAGSAPHGVIIGPDQAAWITDGGQNAIVRVDPKTLAVTRFPLPKDRPNANLNTAVFDKRGHLWFTGQSGIYGELDPARASLRVFDAPRGPGPYGICVTPDGSLYFASLAGSYLGRIDPASGAAQVIEPPTPHQGARRVWSDPQGRVWISEWNAGQVGMFDPATHQWREWRLPGSNPHAYAIFVDDRGIVWLSEWSANALVRFDPRTEQFDVLPLPRPHANVRQMMGRPGEVWLSESGTDHLLRYRSRAANAGGNLast
1 -88.300[V] COG4257 Streptogramin lyase  ali  100  1MLATRREPVGTAAKRRPGSGPALSFASALVGAALIIAMGSAPAQPPSFDTFAVPAGSAPHDVAPAPDGTVWYTAQAQGAAGRLDPRSGKADRVPLGAGSAPHGVIIGPDQAAWITDGGQNAIVRVDPKTLAVTRFPLPKDRPNANLNTAVFDKRGHLWFTGQSGIYGELDPARASLRVFDAPRGPGPYGICVTPDGSLYFASLAGSYLGRIDPASGAAQVIEPPTPHQGARRVWSDPQGRVWISEWNAGQVGMFDPATHQWREWRLPGSNPHAYAIFVDDRGIVWLSEWSANALVRFDPRTEQFDVLPLPRPHANVRQMMGRPGEVWLSESGTDHLLRYRSRAANAGGN 349
2 -34.800[T] COG3292 Predicted periplasmic ligand-binding sensor domain  ali follow..  11  244..QSLFVPLEKEVVTLAEQDRAGNWWIGTVN----RGIARLKNQQLQFLEPSRGPYSRVLSWYQDIEGSVWVGTN-AGIMRLRDAPFININSDKGLVGDYVRTLLPLDDRRVMVGT--SRGLSIIEEGLAHSALMPQVGARPSILSLAKADQQGEKVWVGTVQKGLLLWQNGQPVLDENNGLPSSEVRAIVTDPQDNLWIGTSNGIVKRTPQGVLTTYNKDNSPLPDDYIMALAVDSEGKLWVGSAVG--VAYFDAQGKIRPVDLTKQEQAQYVFGFYMESDYVWMAT--DRGIVRYRLSDASVSLVGRAAGDKFFQMLRDSEGHVWLSSNRG--VWKLNYDQ...... 577
3 -29.200[S] COG3391 Uncharacterized conserved protein  ali follow..  10  38..........GDLPEGGALLPTGQITPAAAPGSTFDRLATGLRSD------NNADAAEAVTTALSPDGKTATTTRKAEWVFVFDVSSGKLVRQQINIPNTYNGLAWAKDGSFYVSGGIDDRVYVYAANGNQYKNTPANRVTTGAVVAGLAVSPDGSLVAANFNDSISLVNTANRQVTE-QVPTGEFPFDVALKSTAKVFVSSQRDDEVVAVDVASRVITRIPV---GSQPNKILLSADQNLYVANGNSDTISVIDTNSNRVIGTISLSRGSSPNSLALSPDERLYVTLAGENAVAVVDLRSGRVSG-RIPTGWYPNSVSVSQDGRLFVVNAKSNSGPNPSQSRTT.... 450
4 -28.200[O] KOG3567 Peptidylglycine alpha-amidating monooxygenase  ali follow..  13  405...........GQVSGVALDPKNNLVIFHRGDHVEDTILVIDPNNAAVLQSGKNLFYLPHGLSIDKDGNYWVTDVALHQVFKLDPNNKEGPVLILGR-CQPTDVAVDPTGAIYVSDGCNSRIVQFSPSGKFITQWGEESSGSSTVPHSLALPLLGQLCVADENGRIQCFKTDTKEFVREIKHSSFGIPGLLFAVNGKPHFGDQEPVQGFVMNFSNGEIIDIFKPVRKHMPHDIVASEDGTVYIGDAHTNTVWKFTLTEKLEHRSVKKAGIEEAEAVVETKME----NKPTSSELQKMQEKQKLIKEPGSGVPVVAIAIFIRWKKSRAFGDSEHKLETSSGRVLGRFRG. 808
5 -22.300[C] COG4263 Nitrous oxide reductase  ali follow..  74.........................................GGHSGEVRVLGVPSMRELMRIPVNVDSTGWGLTNESKRVLGDSARFLNGDCH----HPHISMTDGKYDGKLFINDKANSRVARIRLDVMKCDRIVTIPN--VQAIHGLRLQKVPHRYVFCNATLYNAIDAETMEVAW-QVIVDGNLDNTDMDYSGRAASTCYNSEKAVDLGGMMRNERDW---VVFDIPRIEAEIKAKRVTLGDSKVVDGRRKDGKDSPVTRYIPVPKNPHGLNTSPDGK-YFIANGKLSPTCTMIAIERRDVVVGEPELGLGPLHTTFDGRGNAYTTLFIDSQLVKWNLADAV.... 408
6 -21.800[R] KOG0286 G-protein beta subunit  ali follow..  15..........KKQIADARKACADVT------AELVSGLEVVGRVQMRTRRTLRGHLAKIYAMHWATDSKLLVSASQDGKLIVWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSRENVKVSRELSAHTGYLSCCRFLDDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQ-TFTGHESDINAICFFPNGEAICTGSDDASCRLFDLRADQLICFSHESIICGITSVAFSLSGRLLFAGYDDFNCNVWDSMKSERVGILSGHDNRVSCLGVTADGMAVATGSWDSFLKIWN......... 340
7 -21.000[S] COG3204 Uncharacterized protein conserved in bacteria  ali follow..  13  95........................................................NNISSLTWSAQNTLFSTINKPAAIVEMTTNGDFIRTIPLDFVKDLETIEYIGDNQFVISDERDYAIYVISLTPNSEVKIPLQDSPTNCGFEGLAYSRQDHTFWFFKEKNPIEVYKVNGLLSSNELHISDDVSGAEFNQKNTLLVLSHESRALQEVTLVGEVIGEMSLTKGSRGAEGVAMDASGNIYIVS-EPNRFYRFTPQSSH......................................................................................... 323
8 -20.500[S] KOG0296 Angio-associated migratory cell protein (contains WD40 repeats)  ali follow..  61..........KDSVFSVSINPVHSNLCAS--GGGDDLGYIWDITTGEQICQLTGHKDSIVAIDWSFDGTYIATGGMDSQVRLWKSSTGFEFITAFETVDEIVWLSWHPKGLFLAAGCNDGSIWMWSLPSGKVNAGKFIPPGVGKRLATVDDSGTLIVWNPATGAPECRMSSDDHRFDPGNEETAAGWTSFDCNAEGNVLFLGGSSGKVKVVNINSSHILA-SLEAQTESVEAIALCTALPICACASVDGTVALYDSASLKFRKS---PHEQAVIDCKFLPNTPYLLTACADCVIRKWDVRSGQLLGEYTGHQEPILCMAITPDGKRVVTGSDDTELLVFDCEH...... 399
9 -20.300[ABO] KOG1446 Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2  ali follow..  4....................................KLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNIHSSTKVDDTIRYLSLHDNKYLRY----PGHTKKVISLCISPVEDTFLSGSLDKTLRL--DLRSPNCQGLMHLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTGYPNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNVSVLNGDHPGPVQCVQFNPKYMMLASACTNMAFWLPTSEEG..... 316
10 -20.000[G] COG3386 Gluconolactonase  ali follow..  13  1........................................MSATVSLLLDAKDIVGESI--LWCGDEKALYWVDIVGKRIHRLEPENGRHDTWPTP--DFVTSIGMRKDGGFIVG---SRNVCLWTPDGPFEEFAMPEPDLPENRLNEGRVAPDGSFWVATMQGAVYRIDP-TGHVSQLTPNEYGITNTMGWTRDNRFFFADTLANEIYMCDLAARRIRTIVAGFARGLPDGSCLDADDRLWNCRVAGGAVAGFDGAGRLMHLIELPASWPTSCTFGGPVLSTLYVTSARTGDHLDMHPLEGGLFAVEGVGHGVEEPKFGQAPDKF....................... 304
11 -20.000[S] KOG0316 Conserved WD40 repeat-containing protein  ali follow..  10  1.....................................MSATELPTKEAHILKGHEGA-VLAARFNGDGNYALTCGKDRTIRLWNPHRGILIKTYKSHGREVRDVHVTSDNAKFCSCGGDRQVYYWDVSTGRVIR-----RGHDGEVNAVKFNDSSSVVSAGFDRSLRVWDCRSHSVEPVQIIDTFLDTVMSVVLTKTEIIGGSVDGTVRTFDMRIGREMS---DNLGQPVNCISISNDGNCVLAGCLDSTLRLLDRTTGELQVYKGHISKSFKTDCCLTNSDAHVIGGSEDGLVFFWDLVDAKVLS-KFRAHDLVNSIDVDFYLRKFFVAGDKRELPPEGRLYVDFFGR 308
12 -19.700[S] KOG2106 Uncharacterized conserved protein, contains HELP and WD40 domains  ali follow..  234...............AFSKSNGGTN-LCAVDDSNDHVLSVWDWQKEEKLADVKCSNEAVFAADFHPTDTNIIVTCGEITSLLLDTRRKLPLIRS-RKAKVVLCVTFSENGDT-ITGDSSGNILVWGKGTNRISYAVQGAH--EGGISPLCMLRDGTVSGGGKDRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIGTTRNFVLQGTLSGDFTPITQ--GHTDELWGLAIHASKPQFLTCGHDKHATLWDAVGHRPVWDK--IIEDPAQSSGFHPSGSVVAVGTLTGRWFVFDTETKDLVTVHTDGNEQLSVMRYSPDGNFLAIGSHDNCIYIYGVSDNGRK.. 563
13 -19.500[A] KOG1272 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  1................MEISSEDNNLME---KVLPPVEQVLTWTLIQICMQESDVELETKVKKYLRGEGANLETLKDKKLKTQLASREKLYGKSAKAAAKIEKWLLPAEAGYLETEGLEKTWRVKQTDIANEVDILSSRVLPDFGPYKLDFTASGRMLAGGRKGHLALLDMMNMSLIKE-IQVRETVRDVAFLHNDQF-FAAAQKKYAYIYGRDGTELHCLK---ERGPVARLRFLKNHFLLASVNMSGQLHYQDVTHGGMVA-SIRTGKGRTDVMEVNPYNSVVGLGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKIKIWDLRKFEEVQT 330
14 -19.200[S] KOG0271 Notchless-like WD40 repeat-containing protein  ali follow..  10  99....ASIPGHGEPVISAQFSPDGRGLAS---GSGDQTMRIWDIELELPLHTCKSHKSWVLCIAWSPDATKIASACKNGEICIWNAKTGEQIGKTLKRHKQWITSLADPTCRLLASCGKDGNIFIWDTVQGTVVRC----SGHTASVTCLRWGGEGLIYSGSQDRTVKMWRADDGVMCRNMTGHAHWINTLALNTDYALRTSCFEPSKRCIKPDTVEECQK----VAQTRYEAALEIAGGERLVSGSDDFTLFMWNPKETKQSINRMTGHMQLVNQVVFSPDTRYIASASFDKSVKLWCGRTGKYLASLRGHVGPVYQVAWSADSRLLVSGSADSTLKVFELKTKSLYYD 439
15 -19.200[Z] KOG0318 WD40 repeat stress protein/actin interacting protein  ali follow..  23..........RGQPIVLGADPKGK----NFLYTNGNSVIIRNIENPAIADVYTEHSCAVNVAKYSPSGFYIASGDASGKIRIWDTVNKELKNEFQPIAGPIKDISWSPDNQRIVAVGEGREGHVFMSETGTSVG---EISGQSKSINSADFRPARPIVTGSEDNTIAVFEGPPFKFKMTKQDHSRFVQAVRYSPDGKFFASAGFDGKVFLYDGTSSEVGEFGSPAHKGGVYALAWKPDSTQLLTCSGDKTCRLWTVESRELVSEFVMGTTVDDQQVSCLWQGDNLITVSLSGVITYLNVADPSKPLRVVKGHNKPIVLGLSDDRSTIYTGSHDGVVTNWNSGSGT.... 358
16 -19.000[A] KOG0291 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  308.......................................................DVQLTAANYNTRTKVLVVAFSSGAFYLYELPDVNMIHSLSISDYPISAALFNCTGDVALASREIGQLLVWEWQSEQYIM---KQQGHSSEMTCIAYSSDGQIATGGEDSKVKLWNTQSSFCFVTFSEHTSGVTGIQFSRNKKFLVSSSLDGTVRAFDVNRYRNFRTFTSPNPAQFSCVAVDYSGEVVAGGQDVFDIFLWSVKTGKLEIISGHEGPVVSIAFSPVATSSTLVSGSWDKTVKIWNCLESNSEHETIDAVSDVTNVTFSPSGEEIAVATLSGNITIFDIKSAGQVTT 602
17 -19.000[JT] KOG0643 Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1)  ali follow..  10  10.......................................................ERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDADWDTKHVLTGSADNSCRLWDCETGKQLAL-----KTNSAVRTCGFDFGGNIIMFSTDKQMGYQQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLV-NVKEHSRQINDIQLSRDMTMFVTASKDNTAKLFDSTTLEHQKT---RTERPVNSAALSPNYDHVVLGGGQEAARFFHLAFEEEFGRVKGHFGPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFE 322
18 -18.900[T] KOG4378 Nuclear protein COP1  ali follow..  12  1..........................................................MMSNLVEPSWRL-LAASGGDTVKLFDVSADSVLSYTPSPGCAVNSVKWNHTNLVVASTGEDKKISLWRKNGQSLGTVPVTGDSAEECLSAISFSKKGSICSGGTGQIVKIWDLQRKLCIKKLKGHTSTITGVMYNCKDEHLASVSVGGDLIVHNLASGARAT-QVVQFVHVLRLLDYSRSSRLLVTAGDDGTVHLWDTTGRSPKMSWLKQHSAPTAGVCFSPSNEKIIASVGMDKLYTYDSGSRRSSSC-IAYEAPFSSLAFGDNGYILVAGTSNGRVVFYDIRGKP.... 303
19 -18.800[S] KOG0282 mRNA splicing factor  ali follow..  281.....................................IHVWSGHTKGVSAVRLFPLSGHLLLSCSMDCKIWEVYGERRCLRTFIGHSKAVR-----------DICFNTAGTQFLSAAYDRYLKLWDTETGQCISRFTNRKVPYCVKFNPDEDKQNLFVAGMSDKKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIAEPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRKKKIFKGHMVAGYACQVDFSPDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPETSKVITCGWDGLIKLWD......... 579
20 -18.600[A] KOG0285 Pleiotropic regulator 1  ali follow..  12  112....LNNTGNPGKSTAILPAPGSFSERNLSTAALMERMPSR-HAPWKNYRVLQGHLGWVRSVAFDPSNEWFCTGSADRTIKIWDVATGVLKLTLTGHIGQVRGLAVSNRHTYMFSAGDDKQVKCWDLEQNKVIRS----HGHLHGVYCLALHPTLDVVLTGGRDSVCRVWDIRTKMQIFVLPHDSDVFSVLARPTDPQVITGSHDSTIKFWDLRYGK-SMATITNHKKTVRAMALHPKEND-FVSASADNIKKFSLPKGEFCHNMLSLQRDIINAVAVNEDGVM-VTGGDKGGLWFWDWKSGHNFQ-SLESEAGIYAACYDQTGSRLVTCEGDKTIKMWKEDEDA.... 459
21 -18.500[PT] KOG4499 Ca2+-binding protein Regucalcin/SMP30  ali follow..  15  3.........................................SIKIECVLPENCRCGESP--VWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMD--APVSSVALRQSGGYVATI--GTKFCALNWKEQSAVVLTVDNDKKNNRFNDGKVDPAGRYFAGTMAGALYSLFPDHHVKKYFDQVDISN--GLDWSLDHKFYYIDSLSYSVDAFDQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRQTVKLPVDKTTSCCFGGKNYSEMYVTCARDG......................................................... 266
22 -18.500[R] KOG2055 WD40 repeat protein  ali follow..  13  215.....................................................PSHSGIRCMSIHPYFPLLLTCGFDRTLRQLDGKVNPLVTSLHLRSSALQTALFHPDGKRVIAAGRRKYMYIWDLESAQVQKVSRMYGQENPSMERFHVDPTGKIALEGRSGHINLLHALTGQFAT-SFKIEGVLSDVLFTSDGSEMLVLSYGAEVWHFNVEQRSVVRRWQVQDGVSTTHFCLDPSNKYLAIGSKSGIVNIYDLQTSNADA-TLDNITFSINSMSFSQDSQVLASRGKKDTLRLVHVPSFSFRNWPTSATGRVTCLAFGKGGELCVGN-EAGRVGLWKLAHYDLKFV 523
23 -18.400[B] KOG0639 Transducin-like enhancer of split protein (contains WD40 repeats)  ali follow..  441.........GGKPAYSFHVTADGQMQPV---PFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTR-HVYTGGKGCVKVWDISHPGNKS--LNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPT--RIKAELTSSAPACYALAISPDSKCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREG--RQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLH--LHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGA-SIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYE......... 767
24 -18.300[D] KOG0642 Cell-cycle nuclear protein, contains WD-40 repeats  ali follow..  12  464........................................................DGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSVTDAVWGLAYSAAHQLLSCSADGTLRLWNTTEVSVFNDIKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRIL-TTANSSCQINRVISHPTLSISITAHEDRHIKFYDNNTGKLIH-SMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKEFTAHRKKFEESIHDVAFHPSKC-YIASAGADALAKV.......... 778
25 -18.200[G] COG2706 3-carboxymuconate cyclase  ali follow..  11  5.....................................................................VYTASPESQQIHSLNHEGTLTLVQVVDVPGQVQPMVVSPDKRLYVGVRPEFRVLAYRIAPDDGALTFAAESALPGSPTHISTDHHGRFVFVGSYNAVTRLQDGLPVELVDVVEGLDGCHSANITPDNRLWVPALKQDRICLFTSDDGHLVAQEPAVEGAGPRHMVFHPNRQAYCVNELNSSVDVWKNPHGEIECVQTLDMMPAAADIHITPDGRLYACDRTASLITVFSVSEDGSVEGFQPTEAQPRGFNIDNSGKLIAAGQKSHHIAVYTGTQGLLT.. 312
26 -17.900[A] KOG0640 mRNA cleavage stimulating factor complex; subunit 1  ali follow..  13  76...........LPGIDLEFEPEASALAPEPHSYETAYVTSHK--------------QACRAGAFSCDGSLVATGSVDASIKILDVERHPVIRTLYDHTDEVSYLEFHPKEHILASASRDGTVKLFDIAKPSVKKAHKVFTDCEP-VLCLSFHPTGDVAIGTEHNVLRVYDVATTQCFVSAIPSKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRINTIAEAHGGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTTTGKQEHQTEAVFNHTEDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVYITHSPNGPAFLTCSDDFRARFWYRRANN.... 423
27 -17.900[S] COG3490 Uncharacterized protein conserved in bacteria  ali follow..  19  33.............................................................HALERTDAVFASAFRARDIATVSERGEIIDRVALP--ARAHGMATSHATGVAFARRPGTFFMAFDPVQRQEPV-VMHAPENRHFYGHGQFSPDGAILYASENGVIGLYDARNGFARIGEYDAGVGTHDMTVSDDGRLIVIANGGPSLVLLDAATGQLIQMPEQLRQLSTRHVDLGDNGRIWFACQYEGPVGHFSKGEDDLPEETTVRLANYVGAIAVNRREGVGLTSPSGNAAVTLDAKTGSVVS----TVREAAGVATAAGG--IAVSSYDGFFEAIRSDVA---DQ 357
28 -17.800[R] KOG1273 WD40 repeat protein  ali follow..  10  2....................................NAPIIDPLQGDFPEVEYLEHGVIKCVAFNHRGSLLAAGCADGGCVIWDFETRGIAKE--DCSAAITSVSWSKYGHRLLVSAADKSLTLWDVSTGEKIARTILQQPLSSAPMIVDFDIDCTTLLPVSVPEMPDVLAPPQRSKCPESNPPFSPAAACFNKCGDLVYIGNSKGEILIVDYKSVRVLALVSASGAAPVKNIVFSRNGQYLLTNSHDRTIRIYENLLPAFREFQDSVTKMHWKAPCFSGDGEIYIWDRAGHLVKILEGPKEALIDLA--HPVHPIIVSVSLAGLVW-AKDYTENWSAFAPDFKELEEN 365
29 -17.600[R] KOG0315 G-protein beta subunit-like protein (contains WD40 repeats)  ali follow..  11  1.................MGDQQQLILAT---GGYDHTIKVWQAHTGNIKTMRFVETSQVNALDRTPDKTR-LAACGYQCIRLYDLESNCTAPVINGVQKNVTRLGFQEDGNWMFTAGEDHHVRIWDMIAAPPHCSRIFDC--EAPVNAACLHPNQVIAMGSQNGSVFLWDVKSERHERIVPEVDASIQDVAISPDGRYLAAANNKGNCYIWSLTSQDQKMSKIPAHSRYILRCKFSPDSRLLLTTSGDGTVCIWKTDDFSKWR-ELCIENYWVWDAAFSADSKWLFTASSDGIARLWKLQTKSSIRDYTGHTKAITALSFKDEIPVKSTNISDVQSSAKPPTQRD.... 331
30 -17.600[R] KOG0288 WD40 repeat protein TipD  ali follow..  10  188..........KANGLETLARQQVDGIVRRNEDGTDHFVES--TIPSTCANRIHAHEGGCGSIVFEYNSGTLFTGGQDRAVKMWDTNSGTLIKSLYGSLGNILDMAVTHDNKSVIAATSSNNLFVWDVSSGRVRH-TLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLHKGYCTN-TVLFTSNCNAICLSIDGLTVFSGHMDGNLRLWDIQTGKLLS-EVAGHSSAVTSVSLSRNGNRILTSGRDNVHNVFDTRTLEICGTLRASGNSNWSRSCISPDDDYVAAGSADGSVHVWSLSKGNIVSILKEQTSPILCCSWSGIGKPLASADKNGYVCTWT......... 515
31 -17.500[A] KOG0319 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  51.SYTIGDPEDELRITCTAVDKNRNRLLV---AYNNQIIREYSIPLDPARTWKTIHTAPILVMEFNEEGHLLATGSADHIVKVWNLTEQQCTH-TLKGPSVVSAILFGKHEKL-VVGYIEGQLNLYNIMRGAPKKLVNTWKSHNSHITALLQVPDSRVVVALSRDQTMSIHETETQETLRVLPLYESIEGGAIGHNGNL-FTVGEEGVVKEFVIETAKLVR-KKRIASSNLDHLAYDVVSNRFLAISAEQNLIILDFENLKIARQIVGFHDEIYSCCLLGKDESHMAVASNTSEIRLYNTKTLDCQLIRGHTESVLSVVSPTWDTSLLASCSKDNSIIFWRLVTSPENDS 398
32 -17.300[S] KOG0310 Conserved WD40 repeat-containing protein  ali follow..  10  2...............AQPYLPAEKFL----------------SRKQETILLDEDEPAVVSSVRISPKKPYHVATTSSVRLTLYDTVVCEPLNLFSRFKKGVCSIDFRHDGRLLAIGGDEGKVRIFDVEKTTGSSKVALRVMQASTVKSVHFSPRGDTVFSMADDGKIKQ-VNAVPIIEIQAHEDAIRCGAVSSINDHIVLTGGYDHKVRLWDIRSK--EKSLELDCEHPVESVLFLPGEQL-IATAAGPIVKIWDTTTGRQLT-ALQAHYKTVTSLRLATNSTCLLSAGIDRRVNAFRTTNYSLIN-SWSMPSPVLDIDVSRDDQTMAIGMGNLLALYRRAEIKK.... 320
33 -17.300[S] KOG1407 WD40 repeat protein  ali follow..  11  1........................................MEETTIPFKSLHSREKKKVHSVAWNSNGTKLASGSVDQTARIWNIEPHGHSKAKDGHTDSVDQLCWDPKHSDLVATASGDKSVRLDARSGKCTQQV----ELSGENINITYKPDGTHVAVGNRDDELTILDVRKFKPLHRRKFNYEVNEIAWNMPGDFFFLTTGLGTVEVLSYPSLK-PLDTLTAHTAGCYCIAIDPKGRYFAVGSADSLVSLWDISDMLCLR-TFTKLEWPVRTISFNYSGEYIASASEDLFIDIANVQTGR-TVHQIPCRAAMNSVEWNPKYNLLAYAGDDKNPKYNTDEGV..... 306
34 -17.300[R] KOG2919 Guanine nucleotide-binding protein  ali follow..  11  126.......................................................QHYTKGCYWSPDGTCLLVPVHLDGMHVIEMPSDLYSADTVQPARYPHMNSLQPETCLWLATRQHEPIHMWDAFDGSLRCSYSGYDAVDEAAISLAFSHDGEQIYAGYKRCIKIFDTSRPGRFCDDYPVKFAISCIAQTTAHPTLTCGNWHGYIQHFDLRCSHGPLFTLGGHKGGITQLRYGEFGNLFSGARKCDKILQWDMRNQPLVELQRHVDTNQRIQFDLASDSNWLASGDTRGFVNVWDLKKYGDPSVLPLHSDCCNGVALNPAMPILATSSGQFHFTDQSAQGDNVTLN 452
35 -17.200[A] KOG0306 WD40-repeat-containing subunit of the 18S rRNA processing complex  ali follow..  406.TSRITIGGHRSDVRTLSFSSDNIA----VLSAAADSIKIWNRSTLQ--CIRTMTCEYALCSFFVPGDRQVVIGTKTGKLQLYDLASGNLLETIDAHDGALWSMSLSPDQRGFVTGGADKSVKFWDFELVKDENSTQKRLSVDEDVLCVSYSPNQKLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISHDGALIATGSADRNVKIWGLDFGDCHK-SLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQ-TLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWERTREPLILEEEREMEREAEYEESKEDQPAVPGETQGDSYFTGKKTIETVKA 756
36 -17.200[A] KOG0265 U5 snRNP-specific protein-like factor and related proteins  ali follow..  10  55.......................................................EGEIFTAEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGSGAVMEAHFTPDGSHIFTCSTDKTLAFWDIATGQRQR-----KGHGNFVNSVQGSRRGQLLCSGSDDRTIKIWDARKKHAAHTLESPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAV-LHHLRGHSDTITGMSLSPEGDFILTNAMDNTLRVWDVRPYAPGE-HQHNFEKNLLRCAWSPGSDKITSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE...... 347
37 -17.200[S] KOG0295 WD40 repeat-containing protein  ali follow..  64..........NDLESKLQESQREINHGA---PTRDKRQAADWIPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGH--EHTVSSVTFLPTGDFVLSASRDHTIKQDISTGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSVEWAPDTAYTNVTGQQPEGNSTHILFSGSRDRSIKAWNINTGDVLF-TLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR....... 404
38 -17.200[S] KOG0293 WD40 repeat-containing protein  ali follow..  10  274.......................................................TDEVWFLQFSHNGKYLASSSKDQTAIIWEISADSLKHTLVGHHKPVIAILWSPDDRQVLTCGAEEVIRRWDVDSGDCVHM----EKGGISPISCGWYPDGQIIAGMTDRSICMWDLDGREKECWKGQRTQKVSDIAMTDDGKWLVSVCKDSVISLFDREATVERLIEE---EDMITSFSLSNDNKYILVNLLNQEIRLWNIEGDPKIVSRYKGHKRSRFIIRSGYKQAFIASGSEDSQVYIWHRSTGKLIVELPGHAGAVNCVSWSPTNLHMLASASDDGTIRIGLDRINQQNQ 569
39 -17.100[S] KOG0308 Conserved WD40 repeat-containing protein  ali follow..  10  30........................................................SAVSALQYDAQNGRLFTGGSDTIIRTWSVPHHKDAFSARGGVRSPNDMILCGHGKILISASNDTTVKVWNIERDNKHGFIDCIRTHKDYVSCLAYAPIVEAVSASFDHNIFVYDINANFKTVNNLIGKDSIYSLATTPNLSLVLGAGTEKCIRLFDPRTNE-KIMKLRGHTDNVRALVVNDDGTRALSAGSDATIRLWDIGQQRCIA-TCIAHEEGVWTLQVDSSFTTVYSAGKDKMVVKTPLYDFTKSQLLFKEEAPVKKLLLSEKDNLWVGTW-KSDIKRWSIRPSAQLS. 342
40 -17.100[A] KOG0268 Sof1-like rRNA processing protein (contains WD40 repeats)  ali follow..  10  13...YVRETKLDLQRVPRNYDPALHFEVPREYVRALNATKLERVFAKPFLASLDGHRDGVNCLAKHPEKATVLSGACDGEVRIWNLTQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDNIVLYDMRQA--TPLKKVILDMRTNTICWNPMEAIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLG. 361
41 -17.100[T] KOG0279 G protein beta subunit-like protein  ali follow..  11  18VTAIATPVDNSDVIVTSSRDKSIILW----------KLTKEDKSYGVAQRRMTGHSHFVQDVVLSSDGQFALSGSWDGELRLWDLATGESTRRFVGHTKDVLSVAFSTDNRQIVSASRDRTIKLWNTLGECKYTISEADGHK-EWVSCVRFSPNTLIVSASWDKTVKVWNLQNCKLRNTLAGHSGYLNTVAVSPDGSLCASGGKDGVILLWDLAEG--KKLYSLEAGSIIHSLCFSPNRY-WLCAATENSIRIWDLESKSVVE----DLKVDLKAEAEKTDGSTGIGNKTKV--------------------IYCTSLNWSADGNTLFSGYTDGVIRVWGIGR...... 325
42 -17.000[R] KOG1524 WD40 repeat-containing protein CHE-2  ali follow..  2...........................................KLKLSASRKTRHTEMVCGVGWIGTEAI-LSAADDHVFLLTNTATNESQQILNMPETFPRSQTKGGQNDVFAVSTSDGKINILSRNGKVENMV----DAHNGAALCARWNSDGTGLLSSGEDGFVKMWSRSGMLRSVLAQFATAVYCVAWDSTSSNVLYCNADHCYIKSLKMQVAPIKWK--AHDGIILCCDWNPTSDLIVTGGEDLKFKVWDGFGQILFNSS--VHDYPITSISWNTDGTL-FAVGSHNILRLCDKSGWSHSLEK-MNAGSVMALSWSPDGTQLAVGTAAGLVFHAHIIDKRLTYE 304
43 -17.000[R] KOG0646 WD40 repeat protein  ali follow..  10  24.TEQLQFKPCASPAHGLTAVGEKFLASSQLSARNTSGSIFYWSWTKPQAEVKSYPVEPIKALAANNEGTYLVGGGISGDIYLWEVATGKLLKKWHGHYRSVTCLVFSGDDSLLVSGSQDGSIRVWSLIRLFDDFQRQQGNTLTMSVTDIVIDYGGCIISSSEDRTCKVWSLSRGKLLK-NIIFPSVINALALDPGGCVFYAGARDSKIYIGAINATSEYG-SVSEKGKAITCLAYCADGNLLISGSEDGVVCVWDPKSLRHVRTLIHAKGSRKGPVNNIQIVRKTIVANSNKTQVSWKSRGALIPP---PLEKYERPVEDTMDGIVTVDPPPFSDVPVYSSFLSA.... 378
44 -16.900[S] KOG0772 Uncharacterized conserved protein, contains WD40 repeat  ali follow..  11  81..........AGPSSSRAEGPEDSD---DSDFDETEAISIIKLIPAACEAKISHGTQAISALRVEPPGVRFASGGLDYYVKLFDFQKMDDKELLPAESHVINSLAFSPNGETLVVASGEAIIRLLDRAGKQWSETVRGDQNPLNKNEFISCSDDGSLWNLDDHKVITKCINKHRKVIKTKGANGKRPQVCTFSPDGKWIAAGCDDGSVQAWKYGSQYVNYLVRKAHNGSITSIAFSPDSKRLLSRGFDDTLKMWSLDNPKLLVKTGLENAFKSTDCGFSPRAEVVFTGTSPGTLQFFDPMTFDLVYKIDYPGISCHRIQWHPRLNQIIAGLSDGTIHVYYDQTMSQRG. 454
45 -16.800[S] KOG3881 Uncharacterized conserved protein  ali follow..  2.............PRVIPPENLGCPPFRALTFDSLGLIKVTEARGQTWGEMNASRSVLAASIDDRLRNPLLAVARKDGNVEVINPCNGDLHFSYSVFGDRKKIDDQTERSCTLLTCTKKGDVSLRSVKFPDAHGNSTDDASPSGEILVGKVDGSENIWDLEQCTKIWSAKCPPKNNLGIFTPTWFTSATFLSKDDHRKFVTGTKSHQVRLYDISTQRRPVLSFDFRETAITSIAEDPDGHTIYVGNASADLASFDIRTGKLLGSFLGKCSGSIRSVVRHPQHQVIASCGLDRYLRVYDVKTRQLIS-AVFLKQHLTGLVFDSGFSGEETAVANTVAEAATEEKMTIMDQ 380
46 -16.800[R] KOG2444 WD40 repeat protein  ali follow..  10  6..........DNPPLCMKSNKDGSRLVVGFVDGSIRFYDTQQHEEEFQEIWKFQTKSSIRGVDLDEHKKRVYAVTKNRSLCVFDIDTGKVRCILKCHRSVPTAICTLPKSQQLATADESGEVKTWNLDPEVASENANIRKWQDEDINDLKVDVKSNLLATSSDGTLGAYDLRKAKLKMRSELMHSEL--YSVCGTNRSVYVGGEDGYVEVFNLNEGNLLERVESGFEMGVNGIVELRSGLLGLTSQGSNRMRLLNVQPSKRLGYDEKSDDDGIDAITISTDKSTVFTMISMSCTIKKWDMGPIIDEIPILRAQDAKSKKMRKTEGFFDGLVGPKNDSDSDDDDEPKSKK 355
47 -16.500[K] KOG0263 Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA)  ali follow..  11  305....................................HLGPRASLPSVCMYTFHHTNNNMNCAEFSPDSTMIACGFQESYIRLWSIKADKKSLPKLSHSGPVYGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGP---VWDVAFGPFGHYFATASHDQTAQLSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHRGHSVRV-FNGHTQPVTAVAIAPDGHTMASADSEGLIHLWDIGTGRRIK-TMRGHRGNIYSLSFSRESTVLVSGGSDCTVRAWDVFKTNYNNPVSSSLTGSVVTPFSAKTSTFNESTSPDQMVALYTKQTPIFN. 628
48 -16.400[R] KOG0289 mRNA splicing factor  ali follow..  238.............................LTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVFSASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLT-KVTDETSGCSLTCAQFHPDGLFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWDLRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILH---FTEHSGLTTGVAFGHHAKFIASTGMDRSLKFYS................................................... 503
49 -16.300[U] KOG0771 Prolactin regulatory element-binding protein/Protein transport protein SEC12p  ali follow..  10  83.QPIGRRVIGTDLPYRMAIHPRQGGLICALPNSWENIIEDDNEEESEKVVKELKDVGQQLSLSFNQDGTVLATGAEDGTLRVFEWPSMKTLLNESKTHASVKSLTFSESGKF-LVSLGAPLCRVWDVNASAAIASLSKEKDEMFASCRFSVDNSGSAANTQRGGSIITWDTTSWRRRSSKLIKRNNSSAFNVSADGKLLAVGTLEGDVLIIDSTKMQTNQIVKKAHLGLVTALTFSPDSRCLVSVSFDSRARLTVIKQKGEKRRVYLWVAALLFVLVYVVLYYLMVAMGIIH......................................................... 383
50 -16.300[R] KOG1539 WD repeat protein  ali follow..  10  229........ASRGAVTALSFSTDGRPLLAS--GGSFGVISIWNLNKKRQSVIRDAHDSSIISLNFLANEPVLMSASADNSLKMWIFDTNRLLRFRSGHSAPPLCIRFYSNGRHILSAGQDRAFRLFSVIQEQQSRELSQRHISMDTAEAYVWRLQNFVLGEHILKPCPENPTPIKGVFVSRNHLLLAILACAISACGNFAVVGTAGGWIERFNLQSGISSEKRRYAHDGEVIGVACDSTNTLMISAGYHGDLKVWDFKKRELKSQ---DVGCSLVKIVYHRVNGLLATVADDFVIRLYDVVTLKMVREFRGHTDRITDLCFSEDGKWVISSSMDGSLRIWDVILAKQID. 614
51 -16.200[B] KOG0273 Beta-transducin family (WD-40 repeat) protein  ali follow..  190.........VSDLLASGSGDSTARIWNLN-ENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNSDGTLLAMGSYDGFARIWTENGNLASTLG-QHKGPIFALKWNKKGNYVLSAGVDKTTIIWDAHTGEAKQ-----PFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDHPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVH-DLQAHSKEIYTIKWSPTGPMLASASFDSTVRLWDVEQGVCTH-TLMKHQEPVYSVAFSPDGKYLASGSFDKYVHIWNTQSGSLVH-SYQGTGGIFEVCWNARGDKVGASASDGSVCVLD......... 521
52 -16.100[D] KOG1036 Mitotic spindle checkpoint protein BUB3, WD repeat superfamily  ali follow..  10  3.........................................TVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKG-EFLHGGAVLDCCFHDDFSG-FSVGADYKVRRIVFNVGKVRCVEYFDFSILFFYTLCLFCDVTGVITGSWDKTVKCWDPRGASGPERTQVGTYLERVYSMSLVGHRLVVATAGRHVNIYDLRNMSQPEQRRESSKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAAGRDIVYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSPEAIFVRSVNEIEVKPK 345
53 -16.000[A] KOG0647 mRNA export protein (contains WD40 repeats)  ali follow..  2................SFFNRSNTTSAL---GTSTAMANEKDLAND--IVINSPAEDSISDIAFSPQQDMFSASSWDGKVRIWDVQNGVPQGRAQHESSSPLCTRWSNDGTKVASGGCDNALKLYDIASGQTQQIGMHSAPIKVLRFVQCGPSNTECIVTGSWDKTIKYWDMRQPQPVSTVMMPERVYSMDNKQSLLVVATAERHIAIINLANPTTIFKATTSPLKWQ-TRCVACYNEADGYAIGSVEGRCSIRYIDDGMQKKSNGQSLVYPVNSIAFHPLYGTFVTAGGDGTFNFWDKNQRHRLKGYPTLQASIPVCSFNRNGSVFAYALSYDWHQGHMGNRPD.... 344
54 -15.800[R] KOG2321 WD40 repeat protein  ali follow..  1.MSLKVQNPNNVRVYTVSGEGVTQRLPNWISKRKLKKDYALSHRIELLQDFEYP--EASNRIKCTRDGKAMATGVYKPHIKVFDFAEMSLKFERHTDAENVQFEILSDDWTKSVHLQTDRTVDFHSQGGIHYST------RIPKYGRDLKYHYPNDLYLAAAGDEVYRLNLEQGRFLN--DSPTGGVNVIDINPMHQLLAFGTDAGSVEFWDPRDRSVPSTPYSDNSRSVTALKYRNDGLNVAIGLSDGATLLYDLRSSSPYMSKDQGYSMPIKSLH-ALDGTARVLSADSKIIKIWEKDTGKPFS-SIEPTVELNDVCPIEGTGLILTANEGSPMHAFYIPS...... 355
55 -15.700[D] KOG0267 Microtubule severing protein katanin p80 subunit B (contains WD40 repeats)  ali follow..  11  2.....SLCGHTSPVDSVAFNSEEVLVLA---GASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVVSGGLDNVVKVWDLTAGKLLH-----KCHEGPIRSLDFHPLEFLLATGSADRTVKFDLETFELIGTTRPEATGVRAIAFHPDGQT-LFCGLDDGLKVYSWEPVIC--RDGVDMGWSTLGDFCINEGKFIGCSYYRNSVGIWVSDISELEPYSEDKNECMVKRFSVLNDQSE-RMGSGPRGSVSPDYETREIK-----------NIYVDSTGGNLNVAQNPGSLKATLPLESGKVAT 328
56 -15.300[S] KOG4328 WD40 protein  ali follow..  10  224.....................................................PCENVKMVAAGDKLGNVW-NEEDNDGIYLFTPHSAPVSSIVFQQNSLSRVISSSYDGLIRLMDVEKSVFDLVYSTDEAIFSL------------SQRPNDEQSLYFGQDYGVFNVWDLRAGKSVFHWELHERRINSIDFNPQNHVMATSSTDGTACLWDLRSMGAKKLSTVNHSRAVHSAYFSPSGLSLATTSLDNYIGVLSGANFENTCMIYHNNTSSKFKAVWGWDDSYIYVGNLSKKIDVINPKLKRVMELHNPLQRAIPCRIHPYNVGTLAGSTAGGQVYVWTTK....... 516
57 -15.000[A] KOG0272 U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats)  ali follow..  11  217..........PRAKDRLVRAREALE-VPSAARAGRMVEMQKKLQSLAPLCSQVGDTRPVSSAAFSEDSSLLLTSSWSGLCKLWSVPDCELKQTLRGHASYVGGVALRPGVKAMASGGHDGAVKLWGFNNEE--SIADITGHMPHRVSKVAFHPSGRLATACYDSSWRLWDLEQKTEVLHQEGHAKPVHCLSYHSDGSVLVTGGLDAFGRVWDLRTGR-CIMFLEGHLGAVFGVDFSPNGFHIATGSQDNTCKIWDLRRRQPVY-TIPAHTNLISDVKYQQECGSFLVTCSYDSTTKISNKTWQPLKTLQGHDNKVISVDIAPNSQYIATTSFDRTFKLWSPDS...... 553
58 -14.900[S] KOG1409 Uncharacterized conserved protein, contains WD40 repeats and FYVE domains  ali follow..  3...........................AIINQRVEQGESSMGGAKPALLHRITGHVARINDVILLSKDEGVWTASDDRSVRLYLKRDNDQFWPSIFMPVAPTSLYYSEETYKLLVGLINGNVYEFSVADDFNSMTESRKTCHAGPISGLGFALSSELIFSCSRDKSIVWHCSENSNKMGS--YLLENSCTAMVIDLPFVFVGDHGGHVTVLRIVDNQPNLVSKLSAHTNITSLTWDGNKKVLYSGSSDHLIIMWDIGGGRGEAYELNGHNGKVTTLCAAPAAKRLFSADEHGKLMCWDMNCKRVETPEWKTSDCCQKCNQFWNLQAMWQRKVVGLRQHHCRTCGSAVC. 327
59 -14.800[Q] KOG4649 PQQ (pyrrolo-quinoline quinone) repeat protein  ali follow..  9SDTGKCVDASPLVVIPTFDKSSTTVYIG----SHSHRMKAVDFYSGKVKEQILGDRIESSACVSKCGNFIVVGCY-NGLVYVLKSNSGEKYMFTTEDAVKSSATMDPTTGLIYIGSH-DQHAYALDIYRKKCVWKSKCGGTVFSSP--CLNLIPHHLYFATLGGLLLAVNPATGNVI-WKHSCGKPLFSSPQCCSQYICIGCVDG-NLLCFTHFGEQVWQFSTSGPIFSSPCTS-PSEQKIFFGSH-DCFIYCCNMKGHLQWKFETTSRVYATPFAFHNNEMLLAAAST-DGKVWILESQSGQLQ-SVYELPGEVFSSPVVLESMLIIGCR-DNYVYCLDLLGGN.... 344
60 -14.500[R] KOG0322 G-protein beta subunit-like protein GNB1L, contains WD repeats  ali follow..  10  4..........................................LPPDPVFSLRSPDMGAVNSLCFQESDRL-LAGTIKGSVFLWDLQTNRSALHFEVGSDPITSLHHTPDRLV--TQEKGGTITMFSIGGSSYVKERSIPGNHRSALHTNTSKTNEQLLFYPCEESSIGVLHVTDAAAPTQILVPDDPQKPFECASQLFLLAGYESGHFLTWDISSSVI--LDVMELAQDATSVDYDPVTNRGIVGGPTDKLISFSYQRSSMQGSELCIKNPGVNGVRIRPDQKVFASAGWDGRIRIFSWKSLRLAVLTQHKNGGVMDLAFSSQAPIMAAAGMDGQISLWDLYN...... 323
61 -14.200[R] KOG0645 WD40 repeat protein  ali follow..  4.......................................................TGRLWSVAAHPMLPLFATSSQDKSVRIYNSNTYNVHVIDGFHTRSIRRVAWRPIERPVLAVASFDSVVSINEKIDDDWECTAALEGHENEVKCIAWSCNGNYLATCSRDKSVWIEDDEFDCLAVLQEHTQDVKVVTWHPTEDLLVSGSYDNSICFWRDDGDDWALTCQLQGHTNVWALAFSPNGNTLASADNDGNVFLWIKISSN-QTSLPHIHKGAVYTISWMNDATL-CSAGGDGKIVVYQREKHDEALWHVAGVYEINSLEYLRDDRL-LSGGDDGECRVWSFK....... 322
62 -14.100[R] KOG2096 WD40 repeat protein  ali follow..  10  2...............DSVLVVGIASVIL---GALIAVLFFGSYFRKRTSEVQSMAKAEPQDPIRNPKSNHPAPKKNHPKSQASDKNQNKRHH--KGHGDAVTGLCFSSDGKSLATACADGVIRVFKLDDASSKSFNRWEFT-GGHPTAVAFADDASSIVVACHHMSIKWDHHHIHEKRSVLTISGATATYGTADGSVVIASCSEGTDIVLWHGKTGRNLG-HVDTNQLKNHMAAVSPNGRFLAAAAFTADVKVWEIVYQK-RVMQLKGHKSAVTWLCFSPNSEQIITASKDGSIRVWNINVRYHLDED-GNPLHYDRLSLCPEGKI-LAASHGSTLQWLCAETGNVLDT 405
63 -14.100[G] COG2133 Glucose/sorbosone dehydrogenases  ali follow..  12  57..........................................VGWSNDAKPRAPAGDHPRWLLVLPNGDVLVAESNK---PARKDKPKGLRAFAESMLMKKAGAGAPSADRISLLRDQDGD-GIADLKTPFLVNLHSPFGMALVGSTLYVANADAIVAFPYTEGATTIAAGPRKVADLPGGPLNHHTKNIIASPDGTKLYAAVGSAAILEVDLATGKKRVFASGL--RNPVGLSWNPNGQLWTAVNERDELGRPDLVARAIVPDYALGSHTASLGLSARYKDGVFVGQHGSWNRN--PQAGYKVVFIPFSGGKPPVGVTVDNDGALLVADDVGDVVWRVSAGR...... 442
64 -14.000[A] KOG0284 Polyadenylation factor I complex, subunit PFS2  ali follow..  125..IRTAMNKVKCPVYSVCWSPEGKRLIT---GCQTGEFTLWNGTAFNFETILQAHDSAIRALKWASNEQWLLSADQGGYVKYWQPNMNNAHMFSAHKDEAIRGLAFAPTDVKFATASDDGTARVWDFARYTEERV----RGHGAEVRCIDWHPTKGLIATDTQQPVKIWDPKSGSCLATLQEHKSSVMAVEFNKNGNWLLTGGRDHLVKMYDIRMMK-EMRTYRAHKKEVISLAWHPIHELFVSGGGDGSIVYWMVDGEKEIGLLEHAHDQAIWSMKWHPLGHILATGSNDNNTKFWADIFGLSNTNMIGHLDKEREPRMAPPKPSIETQETYRPDTFIPGMGLD.... 473
65 -13.700[S] KOG0294 WD40 repeat-containing protein  ali follow..  10  1....................................................MPPEMEI--IEATNEELLLFKLIKSPTDGFTDSVKFELKQTFADSSYARSITSLAVQWPWVASGGTDGRIFVYDMRTRKQSQIILSHA---GRVNTLKFTPDLSLLSGSDDGHMIATRVGSWTKDWQKAHAGQAVTHVSCHPSSKLALSLGGDQVLNTWNLVNGCTNLKNKATLDFQTGCLSWSKQGDH-FTLSGPLVLEIWGIENAHVMRRIEMPSKPICITWL---DGNECLTGLDNGNIAWISLKDEDDTPPTFILAHEVRVKAIAYLNEFLATVSIAGQIKVWKIDMET.... 292
66 -13.600[S] KOG0283 WD40 repeat-containing protein  ali follow..  404.......................................................EGAVWTIKFSQDAHYLASGGADRVIHVWEVQECELMSMNEGSLTPIHPSLCDSSGNEITVVEKKKKGKGSSGRRHNHIPDYVHVPETLDAILDLSWSKSQLLLSSSMDKTVRLWDIETKTCLKL-FAHNDYVTCIQFSPDENYFLSGSLDAKIRIWSIQDRHVVEWS--DLHEMVTAACYTPDGQGALIGSHKGICRAYDTEDCKLQSNKKSQAKRKITSFQFSPVNPSEVLVTSADSIRILDGSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRST 719
67 -13.600[S] KOG2110 Uncharacterized conserved protein, contains WD40 repeats  ali follow..  2............HFFVRKYRGKAAL----LSIGTFDGYKIYNCDPFGKCFHKIQGATSIVEMLFSTSLVALVEKDDGNKLKLINTKKSTTI-CELTFPTPLLAVKLNRKRLLAVLEEQSNVFAVCALSPNSENCYLAYPDSRDHEPRTEGESSSPNVSNSAVSGQVILWDVINCKQITKIEAHKDSLACLAFNSDGTMLATASDNGRIIRV-PSGQRLYQFRRGSLPAQIYSIAFHPDSSLLTVTSSTQTVHIFRLKEVYSNL-ERQGLLPSSPPPKESLLRRSSRSLIGTQSVSGMLDPERDFAYAHIPGDKVTSIAAFGPDNTIVNVATYDGNLYSFRVNLRT.... 356
68 -13.500[S] COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system  ali follow..  12  92..KPLRITSGLGVSTRPKISPSGRAFSVIWLKSGKQGGDIYVVEDGQARRVTYFGSRNSRVAGWISEDEIVITDFHTTEAYKVNVNNGKTEKLPFGMLS---NIVIKDDIIVIAKGGTKGELWISSDGGKTFEKFV----SLDGNVSWPMIVRERVYFLSDHEGNLYSVDLKGKDLRRHTNFTSSDGKRIVFQNAGDIYLYDPEKDSLTKLDINLPT-VMEYMNEAVVNGNYIALVSRGKVFLMRPWDGPSVQLGKKQG--VKYRQIQVLPNGDVIGVNDEDKLVILGKDGSEKVINKDFSRIERVKVSPDGKK---LLSNNKLELWVYEIDNDNARLIDKSEYDLILE 466
69 -13.400[S] KOG0321 WD40 repeat-containing protein L2DTL  ali follow..  12  127.......................................................NQLPFCLGFANNESLLAVCTETGALELFDSRSARRIHGWLAHNNAIFSVNFSKDDSLLATSSGDQTSKVFDLSTQQCITRLGRRGVDGYHSHSVKQDSPYNLVSCSRDGSIIFWDMRTHGITI-NSGRDCSITSATWLPQSTVISSCSANSALKLWDLRTVHTVRLTTSKRDFGVTNVCTSPDGERIYAASRDSIIYEYSSRHLNSGFCPRLRISSFYVKLACSPDGATLACGGGVQDVFDTTRNCSSSAMLTGGHTKDVTAVDWSSEGQL-ASISDDGSVRVWNSSLHGSAAN 473
70 -13.300[U] KOG0276 Vesicle coat complex COPI, beta` subunit  ali follow..  2..........................................PLRLEIKRKLAQRSERVKSVDLHPTEPWILASLYSGTLCIWNYQTQVMAKSFEVTELPVRSAKFVARKQWVVAGADDMYIRVYNYNTMDKVKV----EAHSDYIRCVAVHPTLPYVLSSSDDMLIKL-EKGWACTQIFEGHSHYVMQVTFNPKDTNTFASASLDRTIKIWNLGSPDPNFTLDAHQKGVNCVDYFTGGDYLITGSDDHTAKVWDYQTKSCVQ-TLEGHTHNVSAVCFHPELPIIITGSEDGTVRIWHATTYRLENTLNYGLERVWAIGYIKSSRRVVIGYDEGTIMVKLGREIPVAS. 307
71 -13.200[R] KOG1334 WD40 repeat protein  ali follow..  10  280..........................................................VSTIHFNQRGTRLASSGDDLRVIVWDWVRQKVLNFESGHDINVIQAKFFPNDSTLAMCGHDGQVRVAELINASYCENTKRVAKHRGPAHELALEPDSPFLTSGEDAVVFTIDLRQDRPASKVVDKKVGLYTISMNPANIYQFAVGGHDQVRIYDQRRIDKKENNGVLKPTNITCVVYSHDGTELLASYNDEDIYLFNSSLSDGAQYVK-NNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIQFMEGDRGDIVNCLEPHPYLPVLATSGLDQHVRIWTPTAKTATE. 598
72 -13.200[R] KOG4497 Uncharacterized conserved protein WDR8, contains WD repeats  ali follow..  8..........KLSSLLCKFSPDGKY----LASCVQYRLVVRDVNTLQILQL-YTCLDQIQHIEWSADSLILCAMYKRGLVQVWSLEQPEWHCKIDEGSAGLVASCWSPDGRILNTTEFHLRITVWSLCTKSVSYIK----YPKACLQGITFTRDGRYMALDCKDYVSIFVCSDWQLLRHFDTDTQDLTGIEWAPNGCVLAVTCLEYKILLYSLDGRLLSTYSAYEWSLGIKSVAWSPSSQFLAVGSYDGKVRILNHVTWKMITEDRANPKMGIGMLAFSPDSYFLATRNDNNAVWVWDIQKLRLFAV-LEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQ. 409
73 -13.000[J] KOG0650 WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis  ali follow..  10  399...........LRCLDLYLCPRAKRVKLNIDAEYL-SPRDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSDDKTVKIWEIATGRCIR-TIETDEVVRCVAWCPNPKSIIAVATGNRLLLVNPKVGDKVLVKKTDDL-FKPIRQVTWHGRGDYLATVMPEGANRSQLSKRRSQIPFSKSKGLIQFVLFHPVKP-CFFVATQHNIRIYDLVKQELVK-KLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLHRNAVRSVAFHLRYPLFASGSDDQAVIVSHGMVKKLQTHEKRDEFGVLDVNWHPVQP-WVFSTGADSTIRL.......... 782
74 -13.000[R] KOG1188 WD40 repeat protein  ali follow..  28.......................................................GIDTSKTVQAGKENLVAVLCSNGSIRIYDKERLNVLREFSGYPGLLNGVRFANSCDSVYSACTDGTVKCWDARVAREKPVQLFKGYPSNIFISFDINCNDHIICAGTEMNSQNLSTTKDSLGAYSETHSDDVTQVRFHPSNNMVVSGSSDGLVNVFDINIDN-ALVTTCNSISSVSCIGWSGKGKQIYCMTHDEGFYWWDLNHLDTDEPVTRLNIQDVREVVNKTDTLHVIGGTNKGRIHLMNCSMSGVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIE.... 354
75 -12.600[R] KOG2394 WD40 protein DMR-N9  ali follow..  134.......................................................NTSMTNTNFDGKGTYLVFNVSDAFICDLNSQEKDPVKSIHFSNSNPMCHAFAKDGHDLLIGLNSGDVYTVSLRQQLQD-------VSKKLVGALHYNKDGSVNNRQDRCTSISWVPGGDGAFVVAHADGNLYNKDGATESTFPAIRDPTQFSVDKAKYSKSN-PVARWHICQGSINSIAFSNDGAHLATVGRDGYLRIFDFLTQKLVC-GGKSYYGALLCCSWSMDGKYILTGGEDDLVQVWSMEDRKVVAWGEGHNSWVSGVAFDSNWSSFGSVGQDTQLLLWDLEMDEIVV. 434

FFAS is supported by the NIH grant R01-GM087218-01
1 2 7 7 0 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Osterman A, Overbeek R, Godzik A. Automatic detection of subsystem/pathway variants in genome analysis. Bioinformatics. 2005 Jun 1;21 Suppl 1:i478-i486.