current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [G] COG4284 UDP-glucose pyrophosphorylase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .
# Score Template Links and tools%idFirst MTDTKQLFIEAGQSQLFHNWESLSRKDQEELLSNLEQISSKRSPAKLLEDCQNAIKFSLANSSKDTGVEISPLPPTSYESLIGNSKKENEYWRLGLEAIGKGEVAVILMAGGQGTRLGSSQPKGCYDIGLPSKKSLFQIQAEKLIRLQDMVKDKKVEIPWYIMTSGPTRAATEAYFQEHNYFGLNKEQITFFNQGTLPAFDLTGKHFLMKDPVNLSQSPDGNGGLYRAIKENKLNEDFDRRGIKHVYMYCVDNVLSKIADPVFIGFAIKHGFELATKAVRKRDAHESVGLIATKNEKPCVIEYSEISNELAEAKDKDGLLKLRAGNIVNHYYLVDLLKRDLDQWCENMPYHIAKKKIPAYDSVTGKYTKPTEPNGIKLEQFIFDVFDTVPLNKFGCLEVDRCKEFSPLKNGPGSKNDNPETSRLAYLKLGTSWLEDAGAIVKDGVLVEVSSKLSYAGENLSQFKGKVFDRSGIVLEKLast
1 -131.000[G] COG4284 UDP-glucose pyrophosphorylase  ali  100  1MTDTKQLFIEAGQSQLFHNWESLSRKDQEELLSNLEQISSKRSPAKLLEDCQNAIKFSLANSSKDTGVEISPLPPTSYESLIGNSKKENEYWRLGLEAIGKGEVAVILMAGGQGTRLGSSQPKGCYDIGLPSKKSLFQIQAEKLIRLQDMVKDKKVEIPWYIMTSGPTRAATEAYFQEHNYFGLNKEQITFFNQGTLPAFDLTGKHFLMKDPVNLSQSPDGNGGLYRAIKENKLNEDFDRRGIKHVYMYCVDNVLSKIADPVFIGFAIKHGFELATKAVRKRDAHESVGLIATKNEKPCVIEYSEISNELAEAKDKDGLLKLRAGNIVNHYYLVDLLKRDLDQWCENMPYHIAKKKIPAYDSVTGKYTKPTEPNGIKLEQFIFDVFDTVPLNKFGCLEVDRCKEFSPLKNGPGSKNDNPETSRLAYLKLGTSWLEDAGAIVKDGVLVEVSSKLSYAGENLSQFKGKVFDRSGIVLEK 477
2 -91.200[M] KOG2388 UDP-N-acetylglucosamine pyrophosphorylase  ali follow..  18  28.IELAKILLENGQSHLFQQWPELGVDDKEKFFDQIARLNSSYP-GGLAAYIKTAKELLADSKVGKNPYDGFSPSVPSGENLTFGTDNFIEMEKRGV--VEARNAAFVLVAGGLGERLGYNGIKVALPRETTTGTCFLQHYIESILALQEASNKSERDIPFIIMTSDDTHSRTLDLLELNSYFGMKPTQVHLLKQEKVACLDDNDARLALDPHNKYSIQIQMDFSSMLVAATQLLCLKVFIQFLMEIHNSLMTS--LVQAIPASLGVSATKQYHVNSLAVPRKAKEAIGGISKLTHSMVINVEYNQLDPLLRASGFPDTGFSPFPGNINQLILELGPYKDELQKTGGAIKEFVNPKYKDS--------TKTAFKSSTRLECMMQDYPKTLPTARVGFTVMDIWLAYAPVKNNPEDAAHSATSGEMAIYRANSLILQKAGVKVEEPVKITWKPKWGMIFSDIK----KKVSGNCEVSQR 525
3 -86.100[G] KOG2638 UDP-glucose pyrophosphorylase  ali follow..  14  3.RFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTAEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVR--NENTFLDLTVQQIEHLN---KTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVK---IYTFNQSRYPRINKESKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILINPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVD--EFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLD------------GGLNVIQLETAVGAAIKSFEN---SLGINVPRSRFLPVKTTSDLLLVMSNLLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508
4 -11.100[M] COG1209 dTDP-glucose pyrophosphorylase  ali follow..  17  4.......................................................................................................RKGIILAGGSGTRL-MAVSKQLLPI---YDKPMIYYPLSTLMLA-----------DILIISTPQDTPRFQQLLGDGSQWGL---NLQYKVQPS----------------------PDGLAQAFIIGEE----------GGDDCALVLGDNIFYGHDLPKLMEAAVNKESGATVFAYHVNDPERYG--VVEFDKNGTAISLEEKPLEPKSN----------YAVTGLYFYDNDVVQMA......................................................................................................................................... 187
5 -11.000[M] KOG1322 GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase  ali follow..  12  78................................................................................................QNADPKNVASIILGGGAGTRLFSKRAKPAVPIG--GCYRLIDIPMSNCI---------NSGIRKIFILTQFNSFSLNRHLSRTYNFGNGVNDGFVEVLAATQTSGDAGKKWF-------------QGTADAVRQFIWVFEDAKTKNVEHVLILSGDH-LYRMDYMNFVQKHIESNADITVSCLPMDESRASDFGLLKIDQSGKIIQFSEKPKSILGLPPKEAAESPYIASMGVYVFRKEVLLKLLRSSYPTIPLAVGEHNVQAFLFND--------EDIGTIGSFFDANLALTEQPPKFQFYDQKTPFFTSPRFLPPTKVDKCRILDSIVSHSVQHSIVGIRSRLESGVELQ---TMMMGADFYQT............... 441
6 -9.840[M] COG1207 N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains)  ali follow..  13  1..................................................................................................MPQNTLNIVILAAGKGTRMYSKMPKVLHEI---GGETMLGRVIDTAAALNPQN---------ICVVVGHGKEQVLDTVKRDVVWVEQTEQL-------------------------------GTGHAVKTALPH--------AAEGRTLVLYGDVPLIDVE--TLETLLEAAGNEVGLLTDVPADPSGLGRIIRDSSGSVAIVEEKDADAAQKAVKE----------NTGILVLPNAKLEAWLNS----------------------------SSNNAQGEYYLTDLIAKAVADKIHPVQVRSSHLAAGVNNKLQL-----AELERIFQTEQAQELLKAGVTLRDPARFDLRGRLKHGQD................... 270
7 -9.330[G] COG0448 ADP-glucose pyrophosphorylase  ali follow..  11  19....................................................................................................VKDTLVLILAGGRGSRLYDKRAKPALYFG--GNRRIIDFALSNCL---------NSGLNRIGVVTQYAAHSLLRHLQNGWSFLPAER---------------GEFIDMLPARQQIDDSTWYRGTADAVYQNMAIIRD--HYCPKYILILAGDH-IYKQDYSQMLLDHIHSGAKCTVGCIEVEREKATEFGVMAVNENLKVKSFVEKP---KDPPAMVGKPNTSLASMGIYVFDADYLYDVLEREVSSLPKALEEGVLYAHPFSRSCMGRNTEGEIYWRD--VGTLDSFWQSNIDLVCENPQLDIYDPIRGNPVQTYPSKFFYKKENARPVDNSLISGGCVITDA---SISYSVLFDRIKINEIDHCVVLPQVTIGKN 378
8 -9.260[MJ] COG1208 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon)  ali follow..  17  1.......................................................................................................MRAVLMAGGSGTRL-CDLPKPMVPI---LNRPIAEHIINLLKR---------HHITEVIATLHYLPDVLRDYFQDGGDFGV---QMTYAVEEDQPL---------------------GTAGCVKNIAEL----------LDETFLVISGDSITDFDLGEAIAFHKQKQSKATLILTRVPNPIEFG--VVITDEAGKIKRFLEKPSTSEIFSD--------TVNTGTYILEPEVLEYLPSNTECDFSKDLFPLLLAKDEPMYGYVAEGYWCDVGHLDAYREAQYDGLDR...................................................................................... 235
9 -9.170[GMO] KOG1460 GDP-mannose pyrophosphorylase  ali follow..  13  1...............................................................................................MGSSMEEKVVAVIMVGGKGTRLSLNIPKPLFPI---AGQPMVHHPISACKRIPNLAQ-------IYLVGFYEEREFALYVSAISNELKV---PVRYLREDK----------------------PHGSAGGLYHFR-----NLIMEDSPSHIFLLNCD-VCCSFPLPKMLEAHRGYGGIGTLLVIKVSPESSQFGELVADPVTNELLHYTEKPETFVSD----------RINCGVYVFTPEIFNAIGDVSTQRKDRATLKRVSSFEALQPATRIPTDF---VRLDQDILSPL----AGKKRLYTYETMDFWEQIKSPGMS............................................................... 267
10 -8.710[H] COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase  ali follow..  14  1.......................................................................................................MLTLLMCGGKGTRLG-RGEKPLFEV---CGMKLIDHSLLQYKDFDVI----------AITSP--HTPATESYLAEKGV-ELAINEPVIVASADIVYIRDIAFDIVDAIKPALTVVMEGEPVGVNIIDSLLINTW-------------QEEEIYSIEKDSVVNVNTVADVERAERLWTTMRKERG.............................................................................................................................................................................................. 177

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 3 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82.