current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [K] COG4738 Predicted transcriptional regulator, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MIVVADNGLISEENDFKMGEVEYEMVELLRRLNINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNHGKGRPVKLYKLTVQMETIIDTIEENVIAESKTILQNIERLKSLSLast
1 -61.100[K] COG4738 Predicted transcriptional regulator  ali  100  1MIVVADNGLISEENDFKMGEVEYEMVELLRRLNINRPVALTLACLSKGDEISSQRIEMVSGLRQPEVSIAMRYLRENEWVDMREEKKNHGKGRPVKLYKLTVQMETIIDTIEENVIAESKTILQNIERLKSLS 133
2 -32.000[K] COG5625 Predicted transcription regulator containing HTH domain  ali follow..  11  4..................EEMLKKLEDLLKAIGLKKNEIRIYRLLVEKRGMRIREIQRELGISERSVRTHVLNLYRRGLLKRELVQSGW-----LGYIYTPVSPLEILQKIKEHLMKSIEELERDLKNQTR.. 112
3 -29.300[K] COG1378 Predicted transcriptional regulators  ali follow..  18  18................TFVVTMDEIIEVLKRLGFRDYEARVYATLATRGEATASEIHRVSGVPRNKVYEVLRSLEDRGMIETIKSSPA---------VFRAIDPESVLEEYKEQLVSAVDTAIRSIRESED.. 123
4 -21.700[K] COG3355 Predicted transcriptional regulator  ali follow..  19...........................IAFMYGLSKSDVEVLHILLQNGKMTTDDLSQKLNVTKASISKALNNLLDKGLIQREKAPAEKEERKGRPNYIYWVEKERLYRKLEADLEKLAGTVKEALQK..... 119
5 -18.200[K] COG1510 Predicted transcriptional regulators  ali follow..  13  1.........MKKTALDIIEHAEEHLIEKIHTFGMPSTVGRVLGIIMNRKPMTLSELSEATGMSKTRMSQVVREMIDANIAEKVFEK-----GVRKDLYDVEQDYQTFISLFAANWTKVVSKNKVLYKKLNR.. 123
6 -16.100[K] COG1846 Transcriptional regulators  ali follow..  13  23................QLRRLESTPRTFGRAGALTPSEIHTIDAIGTDEGLLMKELAERLGVTKGAVSQLVDRLEAKALVRRTAHPKVSRKGREAYRAHADMHAAFYEELQQSFTKEEIAIFEQCVSKLRD.. 145
7 -15.600[K] COG2345 Predicted transcriptional regulator  ali follow..  20  15..................................GDTRRKILLILLERAPVIASDIAEQLQLSTVGVRRHLDNLVEENLAEAANPRQNPMRGRPAKTYRLTDKGRSIFGHEYDSLAAAA.............. 103
8 -15.100[S] COG3373 Uncharacterized protein conserved in archaea  ali follow..  12  8..........................NILRSLNRSELRRKVLFYLLSIYPSYLSEISRAVKSDPSNVKGCLESLIGLGLVIVEQS------KNGFKYFKINPEIVEEVRNMKNMFSDKKVYTVE......... 111
9 -14.600[K] COG1675 Transcription initiation factor IIE, alpha subunit  ali follow..  18  1.................MKAETTTGVEELLNERAAGEVGLILFSLGIEGEFTDDQLSLELGIEINEIRKALFALYEIGLADYVRRRDDE---TGWMEYYWRINYDKALDVLKRELEKTAKKLREKIEAETS.. 114
10 -14.600[S] COG4344 Uncharacterized protein conserved in archaea  ali follow..  12  2......................SEYEKEIDELINDYDMLRVLKHFTIAHVDYAKNITRYTEIPQMRVREYLKRLKDLGLLDYYTNTSIKRTEAKLKYYQINKKAEAVLKEITPKLYVHH.............. 108
11 -14.000[S] COG4519 Uncharacterized protein conserved in bacteria  ali follow..  1............................MELSPVFARRLYLALLVESLERPNVPKLIEKTGWPRRTIQDVIKAMPGIGIELNFVQDGRRHNDGYYQLSDWGPFDSQWVTERKKDIAASLG............. 92
12 -13.900[K] COG1777 Predicted transcriptional regulators  ali follow..  15  1.................MIDDIDNFIAAIE----NSTRREIIRMLTQFERSYALELSRSIGLSQQAILKQLEMLERANLVTSIGFVPSS-VGAKRKLYEPTGFSTLIVDYGRNFLMIQRIPLENDSERVSV.. 109
13 -13.200[K] COG4190 Predicted transcriptional regulator  ali follow..  11  60.........................YDDLMDT-LTPRVLELIEAIRQEEPASINETARVVDRDVKNVHEELSRLAHLGIIFFEEDGQRK............................................ 122
14 -13.100[KH] COG1339 Transcriptional regulator of a riboflavin/FAD biosynthetic operon  ali follow..  16  1.................................MKMKTLFLLIKLAKMGTVTMRELSRELDVSPQTVLRWLEELKEQGYIHKRESRKGT............................................ 62
15 -13.000[K] COG1497 Predicted transcriptional regulator  ali follow..  14  1.........................MKALRKKGELTRFQILSEIAMRQPYVRQKDIADKLGVTVQAVSENIKSLIAEGLVESGSGR---------SHYKITRRGAEKIKEAAMDLRRYADEVLESMSFYRS.. 97
16 -12.300[K] COG4742 Predicted transcriptional regulator  ali follow..  14  4..........................ELIDVVFRSQKRRDLLLLLGE-EPRTMEDIKVLLDVSPTAILPQIKRLTDSNLVIQKNGS-----------YELTDMGEQVFKKARA.................... 78
17 -12.100[S] COG2469 Uncharacterized conserved protein  ali follow..  11  185.....................QNFIEKSKPKEKLSEVEEQILTMVYT--GVDSVSVESILGVTTEELNKMYDRLVNLGLAR---------VVKIRKEIELTPRGVALVSEIMKKAAR................ 269
18 -11.900[K] COG4189 Predicted transcriptional regulator  ali follow..  12  7..................LVDAEKEFDVLKAAA-SLIRVQILKLLHEANGLNVNEIAQRLALPQSTVSAGVAVLEEAGLLRTETRK-----ARKGSQKICFATCDELIVSFRKPETPAASNYIAVAMPLGLYT 115
19 -11.700[K] COG3432 Predicted transcriptional regulator  ali follow..  14  33..................................KRGTMEIMFDILRNPKCGITRVIYGAGINYVVAQKYLDQLVKVGALNIKTENDR-------KIYEITEKGKLLRTHI-EEFIKIRENLYSAKEKVSEL. 124
20 -11.600[K] COG1522 Transcriptional regulators  ali follow..  1............................MSKVELDKIDRKILEVLQSNGRLTNLEVAERVNLSPSPCLRRIRRLEESGVIRQYAALLDPGKGLGLSAYINVRLEKQGGAPKGKAPSDIFRAAVATWPEVVT.. 104
21 -10.900[S] COG3388 Uncharacterized protein conserved in archaea  ali follow..  11  9..........................EIINDMDTLKRHISVINVLLREQPIGIIKLSQETGIPEHKIRYSLRILEQENIISPSREGAI-----------LTPDFIEHKEQIIADAEKVLEEATKIAEDVRKM. 103
22 -10.900[S] COG2512 Uncharacterized membrane-associated protein/domain  ali follow..  10  245................PLSPELCEVLDIIRGHK---------------GRITQKDLRSKLDYSEVKVSLMLSELEKRGLIRKLRNGREN............................................ 302
23 -10.800[S] COG3398 Uncharacterized protein conserved in archaea  ali follow..  17  171................TYGEEEKKVVSALQ----NATNQRIISEIQNGKCNTNLALAREIGVSRATISWYVKNLKETGLIDETRSGRS-------IIYSINPSYEPLIEKY...................... 254
24 -10.700[K] COG5631 Predicted transcription regulator, contains HTH domain (MarR family)  ali follow..  12  64................AFSRWMVRCMAAAGLPGLSPIEILILHSIRHRREKKLADICLALDIETHIATYAIRKLEKAGLLTTGKAAKE-------KTVKITAKGAEACAHYAQIRERLLVDSTANAETLSELA 179
25 -10.700[K] KOG2593 Transcription initiation factor IIE, alpha subunit  ali follow..  11  17......................NNNQKKSAKNGSGGIAVLVLDALTRRQWVREEDLAKELKLNTKQLRTILRYFEEQQFIMRVHRKEKSSATKVHMYSYCCLDYSQIYDVIRYKLHRMKKEFKDVLEDKDN.. 134
26 -10.400[S] COG4861 Uncharacterized protein conserved in bacteria  ali follow..  13  143.................................FTPKRAQVVCVLLDAPQLPLRAIAASAGVSVGMAKETMDTLRTTGFFEHLGSR............................................... 198
27 -9.920[K] COG0640 Predicted transcriptional regulators  ali follow..  25  1....................................................MNEITMQTQADQPKVSSNLAILSEARLVDSIQ------MGREKIYRIAPEKFEDMVDWLDS.................... 55
28 -9.660[K] COG1654 Biotin operon repressor  ali follow..  12  1...............................MKDTTVPLTLISLLADGEFHSGEQLGERLGMSRAAINKHIQTLRDWGV...................................................... 48
29 -9.530[K] KOG2587 RNA polymerase III (C) subunit  ali follow..  14  1.................MSEFGIVYAIHIITVQFGSVVSKVCECLLRKGPLSSRDISRESDINHNKVKDILYLLIQHNCVQAFSIEPPDGSESKAIVQYIVVRYNKFSRIVNEELDSKCGAVLDGL....... 119
30 -9.440[K] COG3682 Predicted transcriptional regulator  ali follow..  10  1...............................MHITAAEAHVMEALWRRSPLSADELGAAQSWGEATVKTLINRLLKKKAIKSERAEGK-------HGYRPLVDRSAYVQAESQGLLDRLPLKPDEVAKLKKL. 114
31 -9.400[K] COG1414 Transcriptional regulator  ali follow..  11  1.................MREPTLETDDRYRAPALDKGLDILELLASVDGGLTQAEIAKHLDRSPNEFYRMLDRLVKRGYVTKLDGDRYS----TLKLFGLAQLHAPVRR-LASFATPFMRELADRSKQANQLA 112
32 -9.340[S] COG4860 Uncharacterized protein conserved in archaea  ali follow..  20  9...................NDPGELVSIFHAAD-SEVKRKLLLDLST-GWITLPVIEQKYG---KEGRRALLYLDKIKMIETQWITGQNGPEK........................................ 77
33 -9.190[T] COG0664 cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases  ali follow..  126..LFTDHPTLAFDLTWIAASEERMLDNHLLSIGRRTAIERAAYLIAFLYPVTQQHVADTLGLSIVHTNKTLRKLVDRGLIRWIDKG............................................... 224

FFAS is supported by the NIH grant R01-GM087218-01
1 3 1 7 3 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Topczewski J, Godzik A., Paszewski A. The Aspergillus nidulans cysA gene encodes a novel type of serine O-acetyltransferase which is homologous to homoserine O-acetyltransferases. Microbiology. 2000 Oct;146 ( Pt 10):2695-703.