current user: public

Please be advised that we have recently moved our server to a new location. We tried our best to fully test all functions on the website, but if something does not work for you please let us know.

Query: [E] COG4917 Ethanolamine utilization protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSELast
1 -83.500[E] COG4917 Ethanolamine utilization protein  ali  100  1MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGDIDTPGEYFNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE 159
2 -33.200[R] KOG2486 Predicted GTPase  ali follow..  17  135LPEFALVGRSNVGKSSLLNSLVRRKRLALKTQCINHFRINLVDLPGYGYASNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASGQNQVPMTLIFTKCDKRKKKKNGGKKPEANI-TTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH....... 318
3 -33.000[R] COG1084 Predicted GTPase  ali follow..  15  162AFTVVIAGFPNVGKSTLLRTLTGAEPEVAD--ERKWKRIQVIDTPGLLDRNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLVFDIPVVTVFNKMDLAENV----KYLEEYINMVEDPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN... 335
4 -32.200[R] COG3596 Predicted GTPase  ali follow..  16  40..VIGIMGKTGAGKSSLCNALFAGEVSPVSD-QIGEHFMTIVDLPGVGESDTEYAALYREQLPRLDLILWLIKADDRDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREP......... 220
5 -32.000[R] COG1159 GTPase  ali follow..  20  11...IAIVGRPNVGKSTLLNKLLGQKISIRKAQTTRHYQAIYVDTPGLHMENRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLRGKAPVILAVNKVDNEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAI......... 177
6 -30.800[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  183...VTIMGHVDHGKTTLLDKFRKTQVAAVETQHIGAFLVTFLDTPG----HAAFSAMRARGAQVTDIVVLVVAADDGKQTVESIQHAKDAQVPIILAVNKCDKAEADPEKVKKELEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGP. 354
7 -30.200[R] COG0218 Predicted GTPase  ali follow..  18  25LPEIALAGRSNVGKSSFINTMLNRKNLARKTQLLNFFNIDFVDVPGYGYARGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEKYYEIPVIIVATKADKIPRKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL............. 195
8 -27.200[P] COG0370 Fe2+ transport system protein B  ali follow..  16  1MSTYCILGNPNTGKTSLFNALTGSYEYVKKVGTLRSKTGKLIDLPGIYDLNPISRDETVVLEEKFDCMLNIVDSSQIERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLRIPILPVVARSGKGTEDILSTLSEKHVAPAIPLVLQYGE 174
9 -26.600[R] COG1160 Predicted GTPases  ali follow..  19  3TPVVALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRIVIDTGGIDGTEEGVEEKMAEAIDEADIVLFLVDARAGLTAADIGIANYLQNKITVVVANKTDGIDADSHCAEFYQLGLG---EIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRT 177
10 -26.200[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  21  448...VTIMGHVDHGKTTLLDRFRESRVTEGETQHIGAYQITFLDTPG----HEAFTSMRARGASVTDITILVVAADDGPQTIEAINHSKAAGVPIIVAINKIDKPGANPQRVTQELTEHGVGSEFVEISAKFNQNLDELLDTVLLVAEVQELKADPTVR. 620
11 -25.200[R] COG2229 Predicted GTPase  ali follow..  19  5..KIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTKVHLYGTPG----QERFNFMWEILSQGSMGLVLLLDNARTNPLKDHSFRGLLEKAPVVVGITKMDIRSQGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPG.......... 175
12 -24.900[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  15  44...IGTIGHVAHGKSTVVKAISGVRFKNELERNITIRHVSFVDCPG----HDILMATMLNGAAVMDAALLLIAGNEPQTSEHLAAIEIMKLKHILILQNKIDLVKERYEQILAFVQGTVAEGPIIPISAQLKYNIEVVCEYIVKKIPVPP......... 247
13 -24.000[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  14  168TRTVLICGYPNVGKSSFMNKVTRADVDVQP--DYKYLRYQVIDTPGIL---EMCSITALAHLRAAVLFFLDISGSAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMESEEDRKLIEEMKSEAVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKK 362
14 -23.800[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  22  3...IVTSGHVDHGKTALLKALTGAHLPEEKKRGMTIDVLGFIDVPG----HEKFLSNMLAGLGGVHYAMLIVAADEVQTKEHLAILRQLQFHEIIVVITKADRTNSAIESLIQTIKQDYSNANYFVTSAETGQGISELRHYLANLAELADTQK...... 169
15 -22.400[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  23  9...IGLVGHVDHGKTTLTKALSGDTHSEETKRGISIRKVSFVDAPG----HETLMATMLSGAALMDGAILVIAANEPQTKEHLMALDVIGVKDVIVVQNKIDIVSKEYREIKEFVKGTCAEDPIIPVSAQQGANIDILIETIEERIKTPK......... 201
16 -22.400[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  17  6..IIGVGGPVGAGKTMLIERLKGYSMAAITNDIYTKEDARILLNTSVLPADRIAGEEMCDKHPDLQLLFLIIDVAQGEKI--PRKGGQGMIKSDLFIINKVDLAPYNVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE...... 206
17 -22.200[M] COG0481 Membrane GTPase LepA  ali follow..  12  4IRNFSIIAHIDHGKSTLSDRLIQDSMDLERERGITIKAQNFIDTPG----HVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMEVVPILNKIDLPAADPERVAEEIEDI-DAMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDPNA.... 189
18 -21.800[J] KOG1191 Mitochondrial GTPase  ali follow..  17  355..QIAIVGRPNVGKSSLLNAWSKSERAIEANVTVRGVPITLLDTAGIRETNDIVEERSETAAKVADVIIMAVSAVEGWTEEDTELLRKYLKQPMILVMNKIDCAPPSCDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEILGLDRVPTGGH... 543
19 -21.700[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  16  22..ELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKI-DIGG----QPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNEPQLAGIPVLVLGNKRDLPGADETGLIERMNLSSIQDRCYSISCKEKDNIDITLQWLIQHSKSQS......... 185
20 -21.700[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  19  56.NTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTLIDVPG----HSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLKNKTPVLLCCNKTDKVTAHTKEFIRSFSHCHNKVTVAEASGLTG-ETDQVQEFIREHVK............ 259
21 -21.400[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  20  42IRNFGIVAHVDHGKSTLADRLLEDKLQVERERGITVKAQNLIDTPG----HVDFSAEVSRSLAVCDGILLLVAANQGAQTIANFWLAFEKNIQIIPVINKIDLPGADIKSVETQLKNL-NPEECLHISAKSGLNVDKVLEAIID............... 209
22 -21.100[R] KOG0410 Predicted GTP binding protein  ali follow..  17  309VPVVSLVGYTNAGKSTLLNQLTGANVTTRRVQMQNGKEFLLTDTVGFIQKLPAAFRATLEEIAESSLLVHVVDISHPLAEQQIEAVEKVMSIPKLVVWNKVDRVDDPQKVKLEAEET----GDTICISALTGEGLDDFCNAVHEKLKDS.......... 475
23 -21.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  18  19..RILILGLDGAGKTTILYRLQVGEVVTTNVEQVTYKNLKFQDLGG----QTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISK-EEELAGAILVVLANKQDMDGCEVHHALGLENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQSRK......... 181
24 -21.000[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  19..RILLLGLDNAGKTTLLKQLASEDISHINIKSVQSQGFKLNDIGGQRKIRPYWKNYF----ENTDILIYVIDSADRKRFEETG-EEKLSCVPVLIFANKQDLLTAPASEIAEGLNLHTIRDRIQSCSALTGEGVQDGMNWVCKNVNAKK......... 181
25 -20.900[R] KOG0395 Ras-related GTPase  ali follow..  14  21..RMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIE--QLDILDTSG----NHPFPAMRRLSILTGDVFILVFSLDNRESFDEKNKTKEAAELPMVICGNKNDHGELCRQVPTTEAELLVSGDAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRK 203
26 -20.900[R] COG0486 Predicted GTPase  ali follow..  15  229..KVVIAGRPNAGKSSLLNALAGREAAIREHIHIDGMPLHIIDTAGLREATDEVEVRAWSEIEQADRILLMLDSTEADNQDLEKVRSLPSNIPVTIVRNKADLSGENEGIVEQN------GYTVITLSAKTQQGIALLREHLKQSMGYQTNMEGG.... 396
27 -20.700[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  25  56...IGTIGHVDHGKTTLTAAITKDKAPEEKARGITIRHYAHVDCPG----HADYIKNMITGAATMDGAIIVVSATDPQTREHLLLARQVGVKQIVVYINKVDMVEPDEMEMRELLSEYGFDDNTPIVSGSALCALEGREPEI................. 226
28 -20.700[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  18  20..RILILGLDGAGKTTILYRLQIGEVVTTNVETLSYKNLKLNDLGG----QTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTAS-EEELQDAALLVFANKQDQPGAEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ......... 182
29 -20.600[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  20  19..RILMVGLDAAGKTTILYKLKLGEIVTTNVETVEYKNISFTDVGG----QDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEAR-EDELRDAVLLVFANKQDLPNANAAEITDKLGLHSLRQRIQSTCATSGEGLYEGLDWLSNNIASKA......... 181
30 -20.400[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  17  23..RILMLGLDAAGKTTILYKLKLNQSVVTNVETVTYKNIKFNDVGG----QDKIRPLWRHYFTGTKGLIFVVDSADSNRISEAR-DREMRDCLLLVLANKQDLPGASPAQITDVLQLDKLKDRVQPTCALTGDGLLEGLAWLSQNAKLK.......... 184
31 -20.400[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  17  18..RLLMLGLDNAGKTTILKKFNGEDIDTINIKTLEHRGFKLNDVGG----QKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQ-EERLAGATLLIFANKQDLPGASSNAIREALELDSIRSHIQGCSAVTGENLLPGIDWLLDDISSR.......... 179
32 -20.400[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  13  19..SILILGLDNAGKTTFLETLKKEYQNVATIPVDSKQILKFWDVGG----QESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHRVLPISALTGEGVKDAIEWMIVRLERNKKSRPP.... 195
33 -20.300[R] COG2262 GTPases  ali follow..  18  197VPTVSLVGYTNAGKSTLFNRITEARVTLRRIDVADVGETVLADTVGFIRHLPAAFKATLQETRQATLLLHVIDAADVRVQENIEAVNTVLEIPTLLVMNKIDMLEDFEPRIDRDEEN---KPIRVWLSAQTGAGIPQLFQALTERLSGE.......... 364
34 -20.000[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  20  22..KILFLGLDNAGKTTLLHMLKDERLVQHEELSIGKIKFKAFDLGG----HQIARRVWKDYYAKVDAVVYLVDAYDKERFAESK-DEALATVPFLILGNKIDIPYASEDELRYHLGLTNFTTEVFMCSIVRKMGYGEGFKWLSQYIN............ 193
35 -19.900[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  12  14..KLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEKFDVWDTAG----QEKFGGLRDGYYINAQCAIIMFDVTSRITNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRK----QYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPA 183
36 -19.900[R] COG5258 GTPase  ali follow..  22  109..TVVALGNVDAGKSTLVGVLTTHEVLTGRTSAVSLR-VLLVDVGG----HERYLRTALRGLSQPDYVMLVVAANSGVQKMTKEHLGIAIGIPVFVVVTRIDITPSEVEEVVRILKMPGVSKPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYG..... 336
37 -19.900[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  19  29..RFLTCGSVDDGKSTLIGRLL-DGLQAEREQGITIRKFIIADTPG----HEQYTRNMATGASTCELAILLIDARKDQTRRHSFISTLLGIKHLVVAINKMDLVDYSREDYLTFAGQLPGNLDIVPLSALEGDNVPTLLEVLETVEIQRVVDAQP.... 245
38 -19.600[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  13  77..KVAFFGRTSSGKSSVINAMLWDKVWPKAKCALLRDDLVLVDSPGT--VTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEWNIFILNNRWDASASEPEYMEDVRRQH-AQNRIFFVSAKEVQEFQNFEQIFEECISQSAVKTK..... 336
39 -19.600[R] COG0536 Predicted GTPase  ali follow..  16  159MADVGLVGFPSAGKSSLISVMSAAKPKIGDVVNVGHETFTMADVPGLISEGKGLGLDFLRHIERTSVLVHVVDTATQSALDEDTGLGDLSQRPRLVVLNKADVPEAEELEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAE 353
40 -19.500[J] COG0050 GTPases - translation elongation factors  ali follow..  22  15...VGTIGHVDHGKTTLTAAITTDNAPEEKARGITIRHYAHVDCPG----HADYVKNMITGAAQMDGAILVVAATDPQTREHILLGRQVGVPYIIVFMNKCDMVDDEEMEVRELLSAYDFPDDLPVVRGSALKALEGEAEWEAKIIELAG......... 194
41 -19.200[R] KOG0394 Ras-related GTPase  ali follow..  16  8LLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADTLQIWDTAG----QERFQSLGVAFYRGADCCVLVYDVNSMKSFLIQASPSDPENFPFVLIGNKVDVDDGNSRVVSKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPD 189
42 -18.600[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  16  16..RIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPVIDTSS----RPEDKGKVVKEVRQADAIVLTFAFDRPETYWLPLFRQLEVRVPIIVAGYEVDNKEAYNHFSIELMKQYREVETSIQWSAQRLDQAKDVLYYAQKAV............. 177
43 -18.500[J] KOG0459 Polypeptide release factor 3  ali follow..  18  103..NVVFIGHVDAGKSTIGGQILFLSGQVDDRQETESTRFTILDAPG----HKSYVPNMISGASQADIGVLVISARKGQTREHVQLAKTLGVSKLIVVVNKMDDPTVNEQKMVPFLKASGYNTKFLPISGLMGKNMDQFFEVLDSIEIPPRDPNGP.... 330
44 -18.400[J] KOG0468 U5 snRNP-specific protein  ali follow..  17  131IRNVALVGHLHHGKTTFVDCLIRQTLFTEQERGCSIKATNIFDTPG----HVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVRQAITVCINKIDRLILELKLPPQDAYF.......................................... 278
45 -18.400[J] COG4108 Peptide chain release factor RF-3  ali follow..  15  15RRTFAIISHPDAGKTTITEKVLLFGRAIQVAGTVKGRGSNLLDTPG----HEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRDTPIVTFMNKLDREIRDPMELMDEVENLKIACSPITWPIGCGKEFKGVYHIHRDETILYTSGQGHTIQE 205
46 -18.300[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  13  339IADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTTVADIPGII-LDKGMGLEFLRHIERSNGWVFVLDLSNKNPIEEVGTLEKVKTKNILIVCNKVDIDAEKSFAKYLQVEKFSKSQDCVPISALREKT......................... 499
47 -18.200[J] KOG0458 Elongation factor 1 alpha  ali follow..  18  169..SFVVLGHVDAGKSTLMGRLLYDLNIVNQSQSTHRANFTIVDAPG----HRDFVPNAIMGISQADMAILCVDCSTNQTKEHMLLASSLGIHNLIIAMNKMDNVDWSQQRLLPYLVDIGFFEDWVPISGFSGEGVPNLMSTLENAAFKISKENEGINKD 398
48 -18.100[R] KOG1673 Ras GTPases  ali follow..  11  103..KISLLGDCQTGKTTFVVKYVGDE-SFLEMTGLNLMDKTF-DVGG---DEKRSKDHIPIACKDAVAILFMFDLTSRSTLNSSQARKWNKTAIPILIGTKFDDFVRLPPNLQWTIVTQARA-SLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLT. 278
49 -18.000[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  23  5LRNIAIIAHVDHGKTTLVDKLL-DSNDQEKERGITILAKNIVDTPG----HADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAAGLRPIVVVNKIDRPGARPDWVIDQIFDL......................................... 147
50 -18.000[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  22  12..NLITIGHVDHGKSTLVGRLLYEHGEIPAHIETDKYYFTLIDAPG----HRDFVKNMITGTSQADAAILVISAREEQTREHAFLARTLGVPQMVVAINKMDATSPPKADAEKLLRSIGFKDSFVPISGYKGDNVTKLLQALDAFKVPEKPINKP.... 229
51 -17.900[R] COG1163 Predicted GTPase  ali follow..  17  65VASVGFVGFPSVGKSTLLSKLTGTESEAAEVIRYKGAKIQMLDLPGIIKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGKTPPDILIKKKEKGGISI................................................... 192
52 -17.800[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  15  64..RVALIGFPSVGKSTLLTMLTGTHSEAASVIHYNDTKIQLLDLPGIISEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAKTPPQIYFKKKKTGGISFTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDV........... 231
53 -17.800[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  20  64DARIGFVGFPSVGKSTLLSNLAGVYSEVAAVIRYKGAKIQLLDLPGIIKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGSKPPNIGFKKKDKGGINL................................................... 191
54 -17.600[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  18  9..NIVVIGHVDSGKSTTTGHLIYKCGGIDKRTETAKYYITIIDAPG----HRDFIKNMITGTSQADCAVLVVACGTGQTREHALLAQTLGVKQLIVACNKMDSTEPPTNEVSGFIKKIGYNPKFVPISGFNGDNMLE...................... 203
55 -17.600[T] KOG4252 GTP-binding protein  ali follow..  12  11..KMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDRLMLWDTAG----QEEFDAITKAYYRGAQACVLVFSTTDRGSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLRRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPE 182
56 -17.500[J] KOG0469 Elongation factor 2  ali follow..  15  19IRNMSVIAHVDHGKSTLTDSLVSKARKDEQERCITIKSTNLIDSPG----HVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAERIKPVLFMNKMDRALLELQLGAEELFQ.......................................... 188
57 -17.200[J] KOG0465 Mitochondrial elongation factor  ali follow..  16  70LRNIGISAHIDSGKTTFTERVLYYTKRIKAIHEVR-YHFNLIDTPG----HIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMYNVPRVTFINKMDRMGSDPFRAIEQLNSLKIPAAAVQIPIGSESSLSGVVDLINRVA............. 250
58 -17.100[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  13  11..KLVFLGDQSVGKTSIITRFMYDKFDTTYQATIGIDRLQLWDTAG----QERFRSLIPSYIRDSSVAVVVYDVANRLS-IEEVRNERAGDVIIVLVGNKTDLVEKRQVSIEEGDSKGREYGMFIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNED 183
59 -16.900[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  14  14..KIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASDLHIWDTAG----QEKYHALGPIYYRGSNGVLLVFDITDRKS-VLEIKTCLGNTAEILIVGNKIDLEEERQVTRQDAEAYAESEGLYMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPS 186
60 -16.900[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  14  10..KILIIGESGVGKSSLLLRFTDDTFDPELAATIGVDKLAIWDTAG----QERFRTLTPSYYRGAQGVILVYDVTRRDTLNELETYCTRNDIVNMLVGNKIDKENREVDRNEGLKFARKHSMLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQN 182
61 -16.700[R] KOG0393 Ras-related small GTPase, Rho type  ali follow..  15  5..KCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVRPINLSLWDTAG----QDDYDQFRHLSFPQTDVFLVCFALNNPASKWYPEVSHHCPNTPIILVGTKADLREDRDTIERYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKK 189
62 -16.700[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  12  22..KLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAKFEIWDTAG----QERYHSLAPMYYRGAQAAIVVYDITNEES-VKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSA 194
63 -16.600[T] KOG3886 GTP-binding protein  ali follow..  16  40KKKVLLMGKSGSGKTSMRSIIFANDVEHSHVRFLGNLVLNLWDCGGQ-FMENYFTSQRDNIFRNVEVLIYVFDVESREQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEM..... 250
64 -16.500[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  15  10LFKLLIIGDSGVGKSSLLLRFADNTFSENYITTIGVDKLQIWDTAG----QERFRTITSTYYRGTHGVVVVYDVTNGESRWLQEIENNCDSVQKVLVGNKCEENERRVVLESDARNYAQSMNSFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASK 183
65 -16.300[J] COG0480 Translation elongation factors (GTPases)  ali follow..  17  10VRNIGIAAHIDAGKTTTTERILFYSGIIHKIGEVH-YQINIIDTPG----HVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQAYKVPRIAFINKMDRTGANFYRVHEQMRDLRANAIAIQLPIGSENDFKGIVDLVRKRA............. 183
66 -16.100[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  12  9QFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDKLQLWDTAG----QERFRSITKSYYRNSVGVLLVYDISNHASMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTEEAQKFAKQFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAED 188
67 -16.100[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  13  9LIKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVGIDHLQLWDTAG----QERFRSLTTAFFRDAMGFLLLFDLTNEQSISQLQMHAYCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWI 194
68 -16.000[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  15  63.PRILLMGLRRSGKSSIQKVVFHKKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDY--MIFRGTGALIFVIDSQDDYMEALARLHLTVTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLFYLTSIYDHSIFEAFSKVVQKL............. 237
69 -15.900[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  15  9LFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVGKLQIWDTAG----QERFRSITQSYYRSANALILTYDITCEES-LREIEQYASNKVITVLVGNKIDLAERREVSQQRAEEFSEAQDYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNV 183
70 -15.800[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  13  8LFKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIGVEKLQIWDTAG----QERFRSVTRSYYRGAAGALLVYDITSRET-LTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENEMFLETSALTGENVEEAFLKCARTILNKIDSGELDPER 182
71 -15.700[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  16  22MFKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDKLQIWDTAG----QERYRTITTAYYRGAMGFILMYDITNEES-STQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADP 196
72 -15.700[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  16  8LFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDKLQIWDTAG----QERFRTITSSYYRGAHGIIVTYDVTDLES-LNEIDRYASENVNKLLVGNKCDLTSQKVVSTETAKAFADELGPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSK 182
73 -15.500[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  17  468MGKVIMLGDSGVGKTSLLIRFRDGR-YFLSTVGIDFRNKVVVDTAG----QERFRSVTHAYYRDAHALLLLYDVTNKTT---GEIREYAQEDVVIVLINKADCSGSERQVKREDGERLGREHNVMETSAKTGLNVELSFTAVARQLKSRGYEHGDD... 641
74 -15.500[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  13  9LIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDKLQIWDTAG----QERFRTITTAYYRGAMGILLLYDVTDKKS-FSNVEQHASENVYKILIGNKCDCEDQRQVSFEQGQALADELGKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSN 183
75 -15.400[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  11  11IFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEKLQIWDTAG----QERFRAVTRSYYRGAAGALMVYDITRRST-LTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNA 185

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 1 7 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.